Shopping Cart
- Remove All
- Your shopping cart is currently empty
Myoregulin (MLN peptide), a regulin family member, modulates muscle performance through intracellular calcium handling. It directly interacts with the sarcoplasmic reticulum Ca^2+-ATPase (SERCA), impeding Ca^2+ uptake into the sarcoplasmic reticulum [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Myoregulin (MLN peptide), a regulin family member, modulates muscle performance through intracellular calcium handling. It directly interacts with the sarcoplasmic reticulum Ca^2+-ATPase (SERCA), impeding Ca^2+ uptake into the sarcoplasmic reticulum [1] [2]. |
Alias | MLN peptide |
Molecular Weight | 5175.17 |
Formula | C239H391N53O67S3 |
Sequence | Met-Ser-Gly-Lys-Ser-Trp-Val-Leu-Ile-Ser-Thr-Thr-Ser-Pro-Gln-Ser-Leu-Glu-Asp-Glu-Ile-Leu-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Leu-Phe-Val-Asp-Leu-Met-Ser-Ile-Met-Tyr-Val-Val-Ile-Thr-Ser |
Sequence Short | MSGKSWVLISTTSPQSLEDEILGRLLKILFVLFVDLMSIMYVVITS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.