Shopping Cart
- Remove All
- Your shopping cart is currently empty
Myoregulin (MLN peptide) TFA, belonging to the regulin family, is a regulator of muscle performance through modulation of intracellular calcium dynamics. It specifically interacts with sarcoplasmic reticulum Ca2+-ATPase (SERCA) and impedes Ca2+ uptake into the sarcoplasmic reticulum [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Myoregulin (MLN peptide) TFA, belonging to the regulin family, is a regulator of muscle performance through modulation of intracellular calcium dynamics. It specifically interacts with sarcoplasmic reticulum Ca2+-ATPase (SERCA) and impedes Ca2+ uptake into the sarcoplasmic reticulum [1] [2]. |
Synonyms | MLN peptide TFA |
Molecular Weight | 5175.17 (free base) |
Formula | C239H391N53O67S3.xC2HF3O2 |
Sequence | Met-Ser-Gly-Lys-Ser-Trp-Val-Leu-Ile-Ser-Thr-Thr-Ser-Pro-Gln-Ser-Leu-Glu-Asp-Glu-Ile-Leu-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Leu-Phe-Val-Asp-Leu-Met-Ser-Ile-Met-Tyr-Val-Val-Ile-Thr-Ser |
Sequence Short | MSGKSWVLISTTSPQSLEDEILGRLLKILFVLFVDLMSIMYVVITS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.