Shopping Cart
Remove All
Your shopping cart is currently empty
This is a fragment of beta-amyloid peptide. It has amino acids 1 through 34.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | This is a fragment of beta-amyloid peptide. It has amino acids 1 through 34. |
| Synonyms | β-Amyloid 1-34 |
| Molecular Weight | 3787.2 |
| Formula | C170H253N47O52 |
| Cas No. | 186359-65-9 |
| Relative Density. | no data available |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu |
| Sequence Short | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.