Shopping Cart
- Remove All
- Your shopping cart is currently empty
This is a fragment of beta-amyloid peptide. It has amino acids 1 through 34.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | This is a fragment of beta-amyloid peptide. It has amino acids 1 through 34. |
Synonyms | β-Amyloid 1-34 |
Molecular Weight | 3787.2 |
Formula | C170H253N47O52 |
Cas No. | 186359-65-9 |
Relative Density. | no data available |
Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu |
Sequence Short | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.