Shopping Cart
Remove All
Your shopping cart is currently empty
β-Amyloid (1-37) (human) is potentially associated with mental status in Alzheimer's disease.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $557 | Backorder | Backorder |
| Description | β-Amyloid (1-37) (human) is potentially associated with mental status in Alzheimer's disease. |
| Molecular Weight | 4074.55 |
| Formula | C182H274N50O55S |
| Cas No. | 186359-67-1 |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly |
| Sequence Short | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | DMSO: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.