Shopping Cart
- Remove All
- Your shopping cart is currently empty
Amyloid β1-40 is one of the fragments generated after cleavage of the amyloid peptide precursor protein by β and γ secretases.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $1,980 | 35 days |
Description | Amyloid β1-40 is one of the fragments generated after cleavage of the amyloid peptide precursor protein by β and γ secretases. |
Synonyms | β-Amyloid 1-40 |
Molecular Weight | 4329.82 |
Formula | C194H295N53O58S |
Cas No. | 131438-79-4 |
Relative Density. | no data available |
Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
Sequence Short | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.