Shopping Cart
- Remove All
- Your shopping cart is currently empty
Rat form of the beta-Amyloid (1-40) peptide
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $162 | Backorder |
Description | Rat form of the beta-Amyloid (1-40) peptide |
Alias | Amyloid β-peptide (1-40) rat |
Molecular Weight | 4233.76 |
Formula | C190H291N51O57S |
Cas No. | 144409-98-3 |
Relative Density. | no data available |
Sequence | Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
Sequence Short | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.