Shopping Cart
- Remove All
- Your shopping cart is currently empty
Prepro VIP (81-122), human, is a peptide derived from prepro-vasoactive intestinal polypeptide (VIP), corresponding to residues 81-122.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Prepro VIP (81-122), human, is a peptide derived from prepro-vasoactive intestinal polypeptide (VIP), corresponding to residues 81-122. |
Molecular Weight | 4552.13 |
Formula | C202H325N53O64S |
Cas No. | 111366-38-2 |
Relative Density. | 1.31g/cm3 |
Sequence | His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-Gly-Lys-Arg-Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val |
Sequence Short | HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.