Shopping Cart
- Remove All
- Your shopping cart is currently empty
[Arg-15,-20,-21, Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic analogue of PACAP 1-27 that exhibits a relaxant effect [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | [Arg-15,-20,-21, Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic analogue of PACAP 1-27 that exhibits a relaxant effect [1]. |
In vitro | The compound '[Arg-15,-20,-21,Leu17]-PACAP-Gly-Lys-Arg-NH2' (BM-PACAP) at a concentration of 0.1 μM demonstrated a more prolonged relaxation effect on human bronchial smooth muscle in vitro, compared to PACAP 1-27, over an observation period of 0-5 hours [1]. |
Synonyms | BM-PACAP |
Molecular Weight | 3555.02 |
Formula | C157H253N53O42 |
Cas No. | 176785-25-4 |
Sequence Short | HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.