Shopping Cart
Remove All
Your shopping cart is currently empty
[Arg-15,-20,-21, Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic analogue of PACAP 1-27 that exhibits a relaxant effect [1].
![[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2](https://cdn.targetmol.com/group3/M00/03/41/CgoaEGY7S5iEVqFnAAAAAMS-RPc211.png)
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Backorder | Backorder | |
| 50 mg | Inquiry | Backorder | Backorder |
| Description | [Arg-15,-20,-21, Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic analogue of PACAP 1-27 that exhibits a relaxant effect [1]. |
| In vitro | The compound '[Arg-15,-20,-21,Leu17]-PACAP-Gly-Lys-Arg-NH2' (BM-PACAP) at a concentration of 0.1 μM demonstrated a more prolonged relaxation effect on human bronchial smooth muscle in vitro, compared to PACAP 1-27, over an observation period of 0-5 hours [1]. |
| Synonyms | BM-PACAP |
| Molecular Weight | 3555.02 |
| Formula | C157H253N53O42 |
| Cas No. | 176785-25-4 |
| Sequence Short | HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.