Shopping Cart
Remove All
Your shopping cart is currently empty
PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 μg | $713 | 35 days | 35 days |
| Description | PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats. |
| Synonyms | PACAP 1-27 |
| Molecular Weight | 3147.66 |
| Formula | C142H224N40O39S |
| Cas No. | 127317-03-7 |
| Relative Density. | 1.45 g/cm3 (Predicted) |
| Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 |
| Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.