Shopping Cart
- Remove All
- Your shopping cart is currently empty
PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 μg | TBD | 35 days |
Description | PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats. |
Alias | PACAP 1-27 |
Molecular Weight | 3147.66 |
Formula | C142H224N40O39S |
Cas No. | 127317-03-7 |
Relative Density. | 1.45 g/cm3 (Predicted) |
Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 |
Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.