Your shopping cart is currently empty

Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $98 | In Stock | In Stock | |
| 5 mg | $228 | In Stock | In Stock | |
| 10 mg | $347 | In Stock | In Stock | |
| 25 mg | $589 | In Stock | In Stock | |
| 50 mg | $842 | In Stock | In Stock | |
| 100 mg | $1,160 | In Stock | In Stock | |
| 200 mg | $1,560 | - | In Stock |
| Description | Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion. |
| In vivo | GLP-1(7-37) (0.5, 5, or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of glucose-stimulated plasma insulin concentration and an increased glucose infusion rate in rats[2]. Continuous infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 to 7 hours maintains a sustained increase in plasma insulin levels compared to vehicle-infused rats with glucose concentration held at 11 mM[2]. |
| Synonyms | GLP-1(7-37) acetate |
| Molecular Weight | 3355.67 |
| Formula | C151H228N40O47 |
| Cas No. | 1450806-98-0 |
| Smiles | O=C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H]([C@H](O)C)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCNC(N)=N)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC6=CNC=N6)N |
| Relative Density. | no data available |
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Sequence Short | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||||||||||||
| Solubility Information | DMSO: 6.71 mg/mL (2 mM), Sonication and heating are recommended. H2O: 81.7 mg/mL (24.35 mM), , when pH is adjusted to 1 with HCl. Sonication is recommended. | ||||||||||||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||||||||||||
DMSO/H2O
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.