Shopping Cart
- Remove All
- Your shopping cart is currently empty
Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $98 | In Stock | |
5 mg | $228 | In Stock | |
10 mg | $347 | In Stock | |
25 mg | $589 | In Stock | |
50 mg | $842 | In Stock | |
100 mg | $1,160 | In Stock | |
200 mg | $1,560 | In Stock |
Description | Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion. |
In vivo | GLP-1(7-37) (0.5, 5, or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of glucose-stimulated plasma insulin concentration and an increased glucose infusion rate in rats[2]. Continuous infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 to 7 hours maintains a sustained increase in plasma insulin levels compared to vehicle-infused rats with glucose concentration held at 11 mM[2]. |
Synonyms | GLP-1(7-37) acetate |
Molecular Weight | 3355.67 |
Formula | C151H228N40O47 |
Cas No. | 1450806-98-0 |
Smiles | O=C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H]([C@H](O)C)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCNC(N)=N)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC6=CNC=N6)N |
Relative Density. | no data available |
Color | White |
Appearance | Solid |
Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
Sequence Short | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
Solubility Information | DMSO: 6.71 mg/mL (2 mM), Sonication and heating are recommended. ![]() H2O: Soluble | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.