Shopping Cart
Remove All
Your shopping cart is currently empty
Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $98 | In Stock | In Stock | |
| 5 mg | $228 | In Stock | In Stock | |
| 10 mg | $347 | In Stock | In Stock | |
| 25 mg | $589 | In Stock | In Stock | |
| 50 mg | $842 | In Stock | In Stock | |
| 100 mg | $1,160 | In Stock | In Stock | |
| 200 mg | $1,560 | - | In Stock |
| Description | Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion. |
| In vivo | GLP-1(7-37) (0.5, 5, or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of glucose-stimulated plasma insulin concentration and an increased glucose infusion rate in rats[2]. Continuous infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 to 7 hours maintains a sustained increase in plasma insulin levels compared to vehicle-infused rats with glucose concentration held at 11 mM[2]. |
| Synonyms | GLP-1(7-37) acetate |
| Molecular Weight | 3355.67 |
| Formula | C151H228N40O47 |
| Cas No. | 1450806-98-0 |
| Smiles | O=C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H]([C@H](O)C)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCNC(N)=N)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC6=CNC=N6)N |
| Relative Density. | no data available |
| Color | White |
| Appearance | Solid |
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Sequence Short | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
| Solubility Information | DMSO: 6.71 mg/mL (2 mM), Sonication and heating are recommended. H2O: Soluble | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
| |||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.