Shopping Cart
- Remove All
- Your shopping cart is currently empty
FS-2 is a potent, specific inhibitor of L-type CaV channels, effectively impeding high K+ or glucose-induced L-type Ca2+ influx in RIN beta cells [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | FS-2 is a potent, specific inhibitor of L-type CaV channels, effectively impeding high K+ or glucose-induced L-type Ca2+ influx in RIN beta cells [1]. |
Molecular Weight | 7018.06 |
Formula | C297H462N92O86S10 |
Sequence | Arg-Ile-Cys-Tyr-Ser-His-Lys-Ala-Ser-Leu-Pro-Arg-Ala-Thr-Lys-Thr-Cys-Val-Glu-Asn-Thr-Cys-Tyr-Lys-Met-Phe-Ile-Arg-Thr-His-Arg-Gln-Tyr-Ile-Ser-Glu-Arg-Gly-Cys-Gly-Cys-Pro-Thr-Ala-Met-Trp-Pro-Tyr-Gln-Thr-Glu-Cys-Cys-Lys-Gly-Asp-Arg-Cys-Asn-Lys (Disulfide brid |
Sequence Short | RICYSHKASLPRATKTCVENTCYKMFIRTHRQYISERGCGCPTAMWPYQTECCKGDRCNK (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52;Cys53-Cys58) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.