Your shopping cart is currently empty

Elastase from porcine pancreas is a serine protease derived from the porcine pancreas, consisting of 240 amino acid residues. It has the ability to hydrolyze proteins and peptides, can induce emphysema in hamsters, and is commonly used to establish animal models of chronic obstructive pulmonary disease (COPD).

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | $37 | In Stock | In Stock | |
| 10 mg | $61 | In Stock | In Stock | |
| 25 mg | $92 | In Stock | In Stock | |
| 50 mg | $145 | In Stock | In Stock | |
| 100 mg | $218 | In Stock | In Stock |
| Description | Elastase from porcine pancreas is a serine protease derived from the porcine pancreas, consisting of 240 amino acid residues. It has the ability to hydrolyze proteins and peptides, can induce emphysema in hamsters, and is commonly used to establish animal models of chronic obstructive pulmonary disease (COPD). |
| In vivo | Elastase from the porcine pancreas could induce emphysema in hamsters [3]. |
| Synonyms | PPE, Porcine Pancreatic Elastase |
| Cas No. | 39445-21-1 |
| Sequence | Val-Val-Gly-Gly-Thr-Glu-Ala-Gln-Arg-Asn-Ser-Trp-Pro-Ser-Gln-Ile-Ser-Leu-Gln-Tyr-Arg-Ser-Gly-Ser-Ser-Trp-Ala-His-Thr-Cys-Gly-Gly-Thr-Leu-Ile-Arg-Gln-Asn-Trp-Val-Met-Thr-Ala-Ala-His-Cys-Val-Asp-Arg-Glu-Leu-Thr-Phe-Arg-Val-Val-Val-Gly-Glu-His-Asn-Leu-Asn-Gln-Asn-Asn-Gly-Thr-Glu-Gln-Tyr-Val-Gly-Val-Gln-Lys-Ile-Val-Val-His-Pro-Tyr-Trp-Asn-Thr-Asp-Asp-Val-Ala-Ala-Gly-Tyr-Asp-Ile-Ala-Leu-Leu-Arg-Leu-Ala-Gln-Ser-Val-Thr-Leu-Asn-Ser-Tyr-Val-Gln-Leu-Gly-Val-Leu-Pro-Arg-Ala-Gly-Thr-Ile-Leu-Ala-Asn-Asn-Ser-Pro-Cys-Tyr-Ile-Thr-Gly-Trp-Gly-Leu-Thr-Arg-Thr-Asn-Gly-Gln-Leu-Ala-Gln-Thr-Leu-Gln-Gln-Ala-Tyr-Leu-Pro-Thr-Val-Asp-Tyr-Ala-Ile-Cys-Ser-Ser-Ser-Ser-Tyr-Trp-Gly-Ser-Thr-Val-Lys-Asn-Ser-Met-Val-Cys-Ala-Gly-Gly-Asn-Gly-Val-Arg-Ser-Gly-Cys-Gln-Gly-Asp-Ser-Gly-Gly-Pro-Leu-His-Cys-Leu-Val-Asn-Gly-Gln-Tyr-Ala-Val-His-Gly-Val-Thr-Ser-Phe-Val-Ser-Arg-Leu-Gly-Cys-Asn-Val-Thr-Arg-Lys-Pro-Thr-Val-Phe-Thr-Arg-Val-Ser-Ala-Tyr-Ile-Ser-Trp-Ile-Asn-Asn-Val-Ile-Ala-Ser-Asn |
| Sequence Short | VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGNGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN (Disulfide bridge: Cys30-Cys46; Cys127-Cys194; Cys158- Cys174; Cys184- Cys214) |
| Storage | keep away from moisture,store at low temperature,keep away from direct sunlight | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: < 1 mg/mL (insoluble), Sonication is recommended. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.