Shopping Cart
- Remove All
- Your shopping cart is currently empty
Porcine pancreatic elastase is a serine protease composed of a single polypeptide chain with 240 amino acid residues. It has the ability to hydrolyze polypeptides and proteins, and can induce emphysema in hamsters.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | $39 | In Stock | |
10 mg | $64 | In Stock | |
25 mg | $97 | In Stock | |
50 mg | $153 | In Stock | |
100 mg | $229 | In Stock | |
200 mg | $342 | In Stock | |
500 mg | $569 | In Stock |
Description | Porcine pancreatic elastase is a serine protease composed of a single polypeptide chain with 240 amino acid residues. It has the ability to hydrolyze polypeptides and proteins, and can induce emphysema in hamsters. |
In vivo | Elastase from the porcine pancreas could induce emphysema in hamsters [3]. |
Alias | PPE, Porcine Pancreatic Elastase |
Cas No. | 39445-21-1 |
Sequence Short | VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGNGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN (Disulfide bri |
Storage | keep away from moisture,store at low temperature,keep away from direct sunlight | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: < 1 mg/mL (insoluble or slightly soluble), Sonication is recommended. ![]() |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.