Shopping Cart
Remove All
Your shopping cart is currently empty
Elastase from porcine pancreas is a serine protease derived from the porcine pancreas, consisting of 240 amino acid residues. It has the ability to hydrolyze proteins and peptides, can induce emphysema in hamsters, and is commonly used to establish animal models of chronic obstructive pulmonary disease (COPD).

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | $39 | In Stock | In Stock | |
| 10 mg | $64 | In Stock | In Stock | |
| 25 mg | $97 | In Stock | In Stock | |
| 50 mg | $153 | In Stock | In Stock | |
| 100 mg | $229 | In Stock | In Stock | |
| 200 mg | $342 | In Stock | In Stock | |
| 500 mg | $569 | - | In Stock |
| Description | Elastase from porcine pancreas is a serine protease derived from the porcine pancreas, consisting of 240 amino acid residues. It has the ability to hydrolyze proteins and peptides, can induce emphysema in hamsters, and is commonly used to establish animal models of chronic obstructive pulmonary disease (COPD). |
| In vivo | Elastase from the porcine pancreas could induce emphysema in hamsters [3]. |
| Synonyms | PPE, Porcine Pancreatic Elastase |
| Cas No. | 39445-21-1 |
| Color | White |
| Appearance | Solid |
| Sequence Short | VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGNGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN (Disulfide bri |
| Storage | keep away from moisture,store at low temperature,keep away from direct sunlight | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: < 1 mg/mL (insoluble or slightly soluble), Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.