Your shopping cart is currently empty

Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $98 | - | In Stock | |
| 5 mg | $198 | 7-10 days | 7-10 days | |
| 10 mg | $288 | 7-10 days | 7-10 days | |
| 25 mg | $445 | 7-10 days | 7-10 days |
| Description | Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause. |
| In vivo | Oral Calcitonin salmon treatment significantly mitigates both fasting and postprandial hyperglycemia in a dose-dependent manner throughout the intervention. By the study's conclusion, this therapy notably reduces diabetic hyperglycemia by approximately 9 mM and lowers HbA1c levels by 1.7%. Additionally, it markedly diminishes glucose fluctuations during the oral glucose tolerance test, indicating improved glycemic control. The treatment also maintains elevated insulin levels while reducing excessive glucagon levels and glucagon-like peptide-1 secretion, primarily in the fasting state. Importantly, it enhances pancreatic beta-cell functionality and increases beta-cell mass, demonstrating its beneficial effects on pancreatic health and function[1]. |
| Synonyms | Salmon calcitonin, Calcitonin salmon |
| Molecular Weight | 3431.85 |
| Formula | C145H240N44O48S2 |
| Cas No. | 47931-85-1 |
| Smiles | C([C@H](CC1=CC=C(O)C=C1)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CN=CN2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC(=O)[C@H]3NC(=O)[C@]([C@@H](C)O)(NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CSSC3)[H])C(C)C)=O)CC(C)C)=O)=O)CCCCN)=O)CC(C)C)=O)CO)=O)CCC(N)=O)=O)CCC(O)=O)=O)CC(C)C)=O)=O)CCCCN)=O)CC(C)C)=O)CCC(N)=O)=O)[C@@H](C)O)=O)(=O)N4[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(NCC(N[C@H](C(=O)N5[C@H](C(N)=O)CCC5)[C@@H](C)O)=O)=O)CO)=O)=O)[C@@H](C)O)=O)CC(N)=O)=O)[C@@H](C)O)=O)CCCNC(=N)N)=O)CCC4 |
| Relative Density. | 1.54 g/cm3 (Predicted) |
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
| Sequence Short | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP (Disulfide bridge: Cys1-Cys7) |
| Storage | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 50 mg/mL (14.57 mM), Sonication is recommended. | ||||||||||||||||||||
| In Vivo Formulation | 10% DMSO+40% PEG300+5% Tween 80+45% Saline: 2 mg/mL (0.58 mM), Sonication is recommended. Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.