Shopping Cart

Your shopping cart is currently empty

Calcitonin (salmon)

Name: Calcitonin (salmon)
Brand: TargetMol
SKU: TP1040
Price: 98 USD
Availability: InStock
Rating: 5 (10 reviews)

Copy Product Info

😃Good

Catalog No. TP1040Cas No. 47931-85-1

Alias Salmon calcitonin, Calcitonin salmon

Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause.

Calcitonin (salmon)

Copy Product Info

😃Good

Purity: 99.80%

Catalog No. TP1040Alias Salmon calcitonin, Calcitonin salmonCas No. 47931-85-1

Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause.

Pack Size	Price	USA Warehouse	Global Warehouse
1 mg	$98	-	In Stock
5 mg	$198	7-10 days	7-10 days
10 mg	$288	7-10 days	7-10 days
25 mg	$445	7-10 days	7-10 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Batch Information

Select Batch

Purity:99.80%

Appearance:Solid

Color:White

Resource Download

COA

Product Introduction

Bioactivity

Description	Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause.
In vivo	Oral Calcitonin salmon treatment significantly mitigates both fasting and postprandial hyperglycemia in a dose-dependent manner throughout the intervention. By the study's conclusion, this therapy notably reduces diabetic hyperglycemia by approximately 9 mM and lowers HbA1c levels by 1.7%. Additionally, it markedly diminishes glucose fluctuations during the oral glucose tolerance test, indicating improved glycemic control. The treatment also maintains elevated insulin levels while reducing excessive glucagon levels and glucagon-like peptide-1 secretion, primarily in the fasting state. Importantly, it enhances pancreatic beta-cell functionality and increases beta-cell mass, demonstrating its beneficial effects on pancreatic health and function[1].
Synonyms	Salmon calcitonin, Calcitonin salmon

Chemical Properties

Molecular Weight	3431.85
Formula	C₁₄₅H₂₄₀N₄₄O₄₈S₂
Cas No.	47931-85-1
Smiles	C([C@H](CC1=CC=C(O)C=C1)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CN=CN2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC(=O)[C@H]3NC(=O)[C@]([C@@H](C)O)(NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CSSC3)[H])C(C)C)=O)CC(C)C)=O)=O)CCCCN)=O)CC(C)C)=O)CO)=O)CCC(N)=O)=O)CCC(O)=O)=O)CC(C)C)=O)=O)CCCCN)=O)CC(C)C)=O)CCC(N)=O)=O)[C@@H](C)O)=O)(=O)N4[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(NCC(N[C@H](C(=O)N5[C@H](C(N)=O)CCC5)[C@@H](C)O)=O)=O)CO)=O)=O)[C@@H](C)O)=O)CC(N)=O)=O)[C@@H](C)O)=O)CCCNC(=N)N)=O)CCC4
Relative Density.	1.54 g/cm3 (Predicted)
Sequence	Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Sequence Short	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP (Disulfide bridge: Cys1-Cys7)

Storage & Solubility Information

Storage

keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

H2O: 50 mg/mL (14.57 mM), Sonication is recommended.

In Vivo Formulation

10% DMSO+40% PEG300+5% Tween 80+45% Saline: 2 mg/mL (0.58 mM), Sonication is recommended.

Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions.

Solution Preparation Table

H2O

	1mg	5mg	10mg	50mg
1 mM	0.2914 mL	1.4569 mL	2.9139 mL	14.5694 mL
5 mM	0.0583 mL	0.2914 mL	0.5828 mL	2.9139 mL
10 mM	0.0291 mL	0.1457 mL	0.2914 mL	1.4569 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc