Shopping Cart
Remove All
Your shopping cart is currently empty
Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $98 | - | In Stock | |
| 5 mg | $198 | 7-10 days | 7-10 days | |
| 10 mg | $288 | 7-10 days | 7-10 days | |
| 25 mg | $445 | 7-10 days | 7-10 days |
| Description | Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause. |
| In vivo | Oral Calcitonin salmon treatment significantly mitigates both fasting and postprandial hyperglycemia in a dose-dependent manner throughout the intervention. By the study's conclusion, this therapy notably reduces diabetic hyperglycemia by approximately 9 mM and lowers HbA1c levels by 1.7%. Additionally, it markedly diminishes glucose fluctuations during the oral glucose tolerance test, indicating improved glycemic control. The treatment also maintains elevated insulin levels while reducing excessive glucagon levels and glucagon-like peptide-1 secretion, primarily in the fasting state. Importantly, it enhances pancreatic beta-cell functionality and increases beta-cell mass, demonstrating its beneficial effects on pancreatic health and function[1]. |
| Synonyms | Salmon calcitonin, Calcitonin salmon |
| Molecular Weight | 3431.85 |
| Formula | C145H240N44O48S2 |
| Cas No. | 47931-85-1 |
| Smiles | C([C@H](CC1=CC=C(O)C=C1)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CN=CN2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC(=O)[C@H]3NC(=O)[C@]([C@@H](C)O)(NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CSSC3)[H])C(C)C)=O)CC(C)C)=O)=O)CCCCN)=O)CC(C)C)=O)CO)=O)CCC(N)=O)=O)CCC(O)=O)=O)CC(C)C)=O)=O)CCCCN)=O)CC(C)C)=O)CCC(N)=O)=O)[C@@H](C)O)=O)(=O)N4[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(NCC(N[C@H](C(=O)N5[C@H](C(N)=O)CCC5)[C@@H](C)O)=O)=O)CO)=O)=O)[C@@H](C)O)=O)CC(N)=O)=O)[C@@H](C)O)=O)CCCNC(=N)N)=O)CCC4 |
| Relative Density. | 1.54 g/cm3 (Predicted) |
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
| Sequence Short | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7) |
| Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 50 mg/mL (14.57 mM), Sonication is recommended. | ||||||||||||||||||||
| In Vivo Formulation | 10% DMSO+40% PEG300+5% Tween 80+45% Saline: 2 mg/mL (0.58 mM), Sonication is recommended. Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
| |||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.