Shopping Cart
- Remove All
- Your shopping cart is currently empty
Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $98 | In Stock | |
5 mg | $198 | 7-10 days | |
10 mg | $288 | 7-10 days | |
25 mg | $445 | 7-10 days |
Description | Calcitonin (salmon), a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause. |
In vivo | Oral Calcitonin salmon treatment significantly mitigates both fasting and postprandial hyperglycemia in a dose-dependent manner throughout the intervention. By the study's conclusion, this therapy notably reduces diabetic hyperglycemia by approximately 9 mM and lowers HbA1c levels by 1.7%. Additionally, it markedly diminishes glucose fluctuations during the oral glucose tolerance test, indicating improved glycemic control. The treatment also maintains elevated insulin levels while reducing excessive glucagon levels and glucagon-like peptide-1 secretion, primarily in the fasting state. Importantly, it enhances pancreatic beta-cell functionality and increases beta-cell mass, demonstrating its beneficial effects on pancreatic health and function[1]. |
Alias | Salmon calcitonin, Calcitonin salmon |
Molecular Weight | 3431.85 |
Formula | C145H240N44O48S2 |
Cas No. | 47931-85-1 |
Smiles | C([C@H](CC1=CC=C(O)C=C1)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CN=CN2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC(=O)[C@H]3NC(=O)[C@]([C@@H](C)O)(NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CSSC3)[H])C(C)C)=O)CC(C)C)=O)=O)CCCCN)=O)CC(C)C)=O)CO)=O)CCC(N)=O)=O)CCC(O)=O)=O)CC(C)C)=O)=O)CCCCN)=O)CC(C)C)=O)CCC(N)=O)=O)[C@@H](C)O)=O)(=O)N4[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(NCC(N[C@H](C(=O)N5[C@H](C(N)=O)CCC5)[C@@H](C)O)=O)=O)CO)=O)=O)[C@@H](C)O)=O)CC(N)=O)=O)[C@@H](C)O)=O)CCCNC(=N)N)=O)CCC4 |
Relative Density. | 1.54 g/cm3 (Predicted) |
Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
Sequence Short | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7) |
Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. | ||||||||||||||||||||
Solubility Information | H2O: 50 mg/mL (14.57 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.