Your shopping cart is currently empty

Calcitonin(salmon)Acetate(47931-85-1(free base))(Salmon calcitonin) , a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $96 | In Stock | In Stock | |
| 2 mg | $123 | In Stock | In Stock | |
| 5 mg | $189 | In Stock | In Stock | |
| 10 mg | $272 | In Stock | In Stock | |
| 25 mg | $422 | In Stock | In Stock | |
| 50 mg | $626 | In Stock | In Stock | |
| 100 mg | $889 | In Stock | In Stock |
| Description | Calcitonin(salmon)Acetate(47931-85-1(free base))(Salmon calcitonin) , a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause. |
| In vivo | Oral Calcitonin salmon treatment dose-dependently attenuates fasting and non-fasted hyperglycaemia during the intervention period. At the end of the study period, oral Calcitonin salmon treatment by dose decreases diabetic hyperglycaemia by ~9 mM and reduces HbA1c levels by 1.7%. Furthermore, a pronounced reduction in glucose excursions is dose-dependently observed for oral Calcitonin salmon treatment during oral glucose tolerance test. In addition, oral Calcitonin salmon treatment sustains hyperinsulinaemia and attenuates hyperglucagonaemia and hypersecretion of total glucagon-like peptide-1 predominantly in the basal state. Lastly, oral Calcitonin salmon treatment dose-dependently improves pancreatic beta-cell function and beta-cell area at study end[1]. |
| Synonyms | Salmon calcitonin |
| Molecular Weight | 3490.94 |
| Formula | C147H243N44O50S2 |
| Smiles | NC(=O)CC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1)C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc2cncn2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](Cc3ccc(O)cc3)C(=O)N5CCC[C@H]5C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H](C(=O)N4CCC[C@H]4C(N)=O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O.CC(=O)O |
| Relative Density. | no data available |
| Sequence | H-Cys(1)-Ser-Asn-Leu-Ser-Thr-Cys(1)-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 |
| Sequence Short | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||
| Solubility Information | DMSO: 5 mM, Sonication is recommended. | |||||||||||||||
Solution Preparation Table | ||||||||||||||||
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | ||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.