Shopping Cart
Remove All
Your shopping cart is currently empty
Calcitonin(salmon)Acetate(47931-85-1(free base))(Salmon calcitonin) , a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $96 | In Stock | In Stock | |
| 2 mg | $123 | In Stock | In Stock | |
| 5 mg | $189 | In Stock | In Stock | |
| 10 mg | $272 | In Stock | In Stock | |
| 25 mg | $422 | In Stock | In Stock | |
| 50 mg | $626 | In Stock | In Stock | |
| 100 mg | $889 | In Stock | In Stock |
| Description | Calcitonin(salmon)Acetate(47931-85-1(free base))(Salmon calcitonin) , a calcium regulating hormone, is used to treat osteoporosis in women who are at least 5 years past menopause. |
| In vivo | Oral Calcitonin salmon treatment dose-dependently attenuates fasting and non-fasted hyperglycaemia during the intervention period. At the end of the study period, oral Calcitonin salmon treatment by dose decreases diabetic hyperglycaemia by ~9 mM and reduces HbA1c levels by 1.7%. Furthermore, a pronounced reduction in glucose excursions is dose-dependently observed for oral Calcitonin salmon treatment during oral glucose tolerance test. In addition, oral Calcitonin salmon treatment sustains hyperinsulinaemia and attenuates hyperglucagonaemia and hypersecretion of total glucagon-like peptide-1 predominantly in the basal state. Lastly, oral Calcitonin salmon treatment dose-dependently improves pancreatic beta-cell function and beta-cell area at study end[1]. |
| Synonyms | Salmon calcitonin |
| Molecular Weight | 3431.85 |
| Formula | C145H240N44O48S2 |
| Smiles | NC(=O)CC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1)C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc2cncn2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](Cc3ccc(O)cc3)C(=O)N5CCC[C@H]5C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H](C(=O)N4CCC[C@H]4C(N)=O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O.CC(=O)O |
| Relative Density. | no data available |
| Sequence | H-Cys(1)-Ser-Asn-Leu-Ser-Thr-Cys(1)-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 |
| Sequence Short | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||
| Solubility Information | DMSO: 5 mM, Sonication is recommended. | |||||||||||||||
Solution Preparation Table | ||||||||||||||||
DMSO
| ||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.