Shopping Cart
- Remove All
- Your shopping cart is currently empty
Cagrilintide, an investigational novel long-acting acylated amylin analogue, functions as an agonist for nonselective amylin receptors (AMYR) and the calcitonin G protein-coupled receptor (CTR). It significantly reduces food intake and induces weight loss, showing promise for obesity research [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Cagrilintide, an investigational novel long-acting acylated amylin analogue, functions as an agonist for nonselective amylin receptors (AMYR) and the calcitonin G protein-coupled receptor (CTR). It significantly reduces food intake and induces weight loss, showing promise for obesity research [1] [2] [3]. |
Molecular Weight | 4409.01 |
Formula | C194H312N54O59S2 |
Cas No. | 1415456-99-3 |
Sequence | {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8) |
Sequence Short | {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.