Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Cagrilintide

Catalog No. T76262 Copy Product Info
Purity: 99.95%
🥰Excellent
Cagrilintide is a long-acting amylin analogue acting as a dual agonist of the amylin receptor and calcitonin receptor, reducing body weight and food intake for obesity research.

Cagrilintide

Copy Product Info
🥰Excellent
Catalog No. T76262

Cagrilintide is a long-acting amylin analogue acting as a dual agonist of the amylin receptor and calcitonin receptor, reducing body weight and food intake for obesity research.

Cagrilintide
Cas No. 1415456-99-3
Pack SizePriceUSA StockGlobal StockQuantity
1 mg$299-In Stock
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
With extensive experience in compound synthesis, we can provide rapid custom synthesis services for this product according to your research needs.
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Batch Information

Select Batch
Purity:99.95%
Appearance:Solid
Color:White
Contact us for more batch information

Resource Download

Product Introduction

Bioactivity
Description
Cagrilintide is a long-acting amylin analogue acting as a dual agonist of the amylin receptor and calcitonin receptor, reducing body weight and food intake for obesity research.
In vivo
Cagrilintide (compound 23) (0.1, 1, 3, 10, and 30 nmol/kg, subcutaneous injection) reduced food intake in rats [2].
Cagrilintide (10 nmol/kg, administered intravenously or subcutaneously) exhibited favorable pharmacokinetic parameters [2].
Chemical Properties
Molecular Weight4409.01
FormulaC194H312N54O59S2
Cas No.1415456-99-3
Sequence{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
Sequence Short{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (Disulfide bridge:Cys3-Cys8)
Storage & Solubility Information
StoragePowder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature.
Solubility Information
H2O: 80 mg/mL (18.14 mM), Sonication is recommended.
Solution Preparation Table
H2O
1mg5mg10mg50mg
1 mM0.2268 mL1.1340 mL2.2681 mL11.3404 mL
5 mM0.0454 mL0.2268 mL0.4536 mL2.2681 mL
10 mM0.0227 mL0.1134 mL0.2268 mL1.1340 mL
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density.

Citations

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experiments For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent 10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.
Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSOTargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSOTargetMol | reagent stock solution to 400 μL PEG300TargetMol | reagent and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH2OTargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Related Tags: buy Cagrilintide | purchase Cagrilintide | Cagrilintide cost | order Cagrilintide | Cagrilintide in vivo | Cagrilintide formula | Cagrilintide molecular weight