Shopping Cart
Remove All
Your shopping cart is currently empty
Cagrilintide acetate
Copy Product Info
🥰Excellent
Synonyms:
Catalog No. T76262L Copy Product Info
Purity: 99.88%
🥰Excellent
Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.
Cagrilintide acetate
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $123 | In Stock | In Stock | |
| 5 mg | $372 | In Stock | In Stock | |
| 10 mg | $596 | In Stock | In Stock | |
| 25 mg | $933 | In Stock | In Stock | |
| 50 mg | $1,250 | In Stock | In Stock | |
| 100 mg | $1,690 | - | In Stock | |
| 200 mg | $2,280 | - | In Stock |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:99.88%
Appearance:Solid
Color:White
Contact us for more batch information
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR. |
| In vivo | Methods: Cagrilintide acetate (0.1, 1, 3, 10, 30 nmol/kg, subcutaneous injection, single administration) was administered to Sprague Dawley male rats to study its effect on food intake. Results: Cagrilintide acetate can reduce the food intake of rats. [1] |
| Molecular Weight | 4469.06 |
| Formula | C196H316N54O61S2 |
| Sequence | {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH₂ (Disulfide bridge:Cys3-Cys8) |
| Sequence Short | EKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Storage | Keep away from moisture,Keep away from direct sunlight,Store at low temperature Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||||||||||||
| Solubility Information | DMSO: 115 mg/mL (25.73 mM), Sonication is recommended.  H2O: 40 mg/mL (8.95 mM), Sonication is recommended. | ||||||||||||||||||||||||||||||
| In Vivo Formulation | 10% DMSO+90% Saline: 10 mg/mL (2.24 mM), Solution. Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions. | ||||||||||||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||||||||||||
H2O/DMSO
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||||||||||||
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, and a total of 10 animals are to be administered, using a formulation of 
10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.Stock Solution Preparation:
Dissolve 2 mg of the compound in 100 μL DMSO to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
Preparation of the In Vivo Formulation:
1) Add 100 μL of the DMSO stock solution to 400 µL PEG300 and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O and mix thoroughly until a homogeneous solution is obtained.
This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: Cagrilintide acetate in vivo | Cagrilintide acetate formula | Cagrilintide acetate molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.