Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Cagrilintide acetate

Catalog No. T76262L Copy Product Info
Purity: 99.88%
🥰Excellent
Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.

Cagrilintide acetate

Copy Product Info
🥰Excellent
Catalog No. T76262L

Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.

Cagrilintide acetate
Pack SizePriceUSA StockGlobal StockQuantity
1 mg$123In StockIn Stock
5 mg$372In StockIn Stock
10 mg$596In StockIn Stock
25 mg$933In StockIn Stock
50 mg$1,250In StockIn Stock
100 mg$1,690-In Stock
200 mg$2,280-In Stock
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Batch Information

Select Batch
Purity:99.88%
Appearance:Solid
Color:White
Contact us for more batch information

Resource Download

Product Introduction

Bioactivity
Description
Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.
In vivo
Methods: Cagrilintide acetate (0.1, 1, 3, 10, 30 nmol/kg, subcutaneous injection, single administration) was administered to Sprague Dawley male rats to study its effect on food intake.
Results: Cagrilintide acetate can reduce the food intake of rats. [1]
Chemical Properties
Molecular Weight4469.06
FormulaC196H316N54O61S2
Sequence{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
Sequence Short{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (Disulfide bridge:Cys3-Cys8)
Storage & Solubility Information
StorageShipping with blue ice/Shipping at ambient temperature.
Solubility Information
DMSO: 80 mg/mL (17.9 mM), Sonication is recommended.
H2O: 40 mg/mL (8.95 mM), Sonication is recommended.
Solution Preparation Table
H2O/DMSO
1mg5mg10mg50mg
1 mM0.2238 mL1.1188 mL2.2376 mL11.1880 mL
5 mM0.0448 mL0.2238 mL0.4475 mL2.2376 mL
DMSO
1mg5mg10mg50mg
10 mM0.0224 mL0.1119 mL0.2238 mL1.1188 mL
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density.

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experiments For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent 10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.
Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSOTargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSOTargetMol | reagent stock solution to 400 μL PEG300TargetMol | reagent and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH2OTargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Related Tags: buy Cagrilintide acetate | purchase Cagrilintide acetate | Cagrilintide acetate cost | order Cagrilintide acetate | Cagrilintide acetate in vivo | Cagrilintide acetate formula | Cagrilintide acetate molecular weight