Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Cagrilintide acetate

🥰Excellent
Catalog No. T76262L

Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.

Cagrilintide acetate

Cagrilintide acetate

🥰Excellent
Purity: 99.88%
Catalog No. T76262L
Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.
Pack SizePriceAvailabilityQuantity
1 mg$129In Stock
5 mg$389In Stock
10 mg$625In Stock
25 mg$972In Stock
50 mg$1,280In Stock
100 mg$1,760In Stock
200 mg$2,380In Stock
Add to Cart
Add to Quotation
Bulk & Custom
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Batch Information

Select Batch
Purity:99.88%
Contact us for more batch information

Resource Download

Product Introduction

Bioactivity
Description
Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.
In vivo
Methods: Cagrilintide acetate (0.1, 1, 3, 10, 30 nmol/kg, subcutaneous injection, single administration) was administered to Sprague Dawley male rats to study its effect on food intake.
Results: Cagrilintide acetate can reduce the food intake of rats. [1]
Chemical Properties
Molecular Weight4469.06
FormulaC196H316N54O61S2
ColorWhite
AppearanceSolid
Sequence{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
Sequence Short{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Storage & Solubility Information
Storagekeep away from moisture,keep away from direct sunlight,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.
Solubility Information
DMSO: 80 mg/mL (17.9 mM), Sonication is recommended.
H2O: 40 mg/mL (8.95 mM), Sonication is recommended.
Solution Preparation Table
H2O/DMSO
1mg5mg10mg50mg
1 mM0.2238 mL1.1188 mL2.2376 mL11.1880 mL
5 mM0.0448 mL0.2238 mL0.4475 mL2.2376 mL
DMSO
1mg5mg10mg50mg
10 mM0.0224 mL0.1119 mL0.2238 mL1.1188 mL

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:
TargetMol | Animal experimentsFor example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。
Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSOTargetMol | reagent (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
Preparation method for in vivo formula: Take 50 μL DMSOTargetMol | reagent main solution, add 300 μLPEG300TargetMol | reagent mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2OTargetMol | reagent mix well and clarify
For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.
All types of co-solvents required for the protocol, such asDMSO, PEG300/ PEG400, Tween 80, SBE-β-CD, corn oil are available for purchase on the TargetMol website with a simple click.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Sci Citations

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Related Tags: buy Cagrilintide acetate | purchase Cagrilintide acetate | Cagrilintide acetate cost | order Cagrilintide acetate | Cagrilintide acetate in vivo | Cagrilintide acetate formula | Cagrilintide acetate molecular weight