Shopping Cart
Remove All
Your shopping cart is currently empty
Cagrilintide acetate
🥰Excellent
Catalog No. T76262L
Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.
Cagrilintide acetate
Cagrilintide acetate
🥰Excellent
Purity: 99.88%
Catalog No. T76262L
Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $123 | - | In Stock | |
| 5 mg | $372 | - | In Stock | |
| 10 mg | $596 | - | In Stock | |
| 25 mg | $933 | - | In Stock | |
| 50 mg | $1,250 | - | In Stock | |
| 100 mg | $1,690 | - | In Stock | |
| 200 mg | $2,280 | - | In Stock |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Batch Information
Select Batch
Purity:99.88%
Contact us for more batch information
Product Introduction
Bioactivity
Chemical Properties
| Description | Cagrilintide acetate is the salt form of Cagrilintide.Cagrilintide is a long-acting amylin analog that is used to treat type 2 diabetes and obesity by reducing appetite through activation of the amylin receptor AMY3R and calcitonin receptor CTR. |
| In vivo | Methods: Cagrilintide acetate (0.1, 1, 3, 10, 30 nmol/kg, subcutaneous injection, single administration) was administered to Sprague Dawley male rats to study its effect on food intake. Results: Cagrilintide acetate can reduce the food intake of rats. [1] |
| Molecular Weight | 4469.06 |
| Formula | C196H316N54O61S2 |
| Color | White |
| Appearance | Solid |
| Sequence | {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8) |
| Sequence Short | {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8) |
Storage & Solubility Information
| Storage | keep away from moisture,keep away from direct sunlight,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | DMSO: 80 mg/mL (17.9 mM), Sonication is recommended. H2O: 40 mg/mL (8.95 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O/DMSO
DMSO
| ||||||||||||||||||||||||||
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:
For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . A total of 10 animals were administered, and the formula you used is 5% 
DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.Preparation method for in vivo formula: Take 50 μL DMSO main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2O mix well and clarify
main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2O mix well and clarifyFor Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: buy Cagrilintide acetate | purchase Cagrilintide acetate | Cagrilintide acetate cost | order Cagrilintide acetate | Cagrilintide acetate in vivo | Cagrilintide acetate formula | Cagrilintide acetate molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.