Shopping Cart
- Remove All
- Your shopping cart is currently empty
Endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | TBD | Backorder | |
5 mg | TBD | Backorder |
Description | Endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption. |
Molecular Weight | 3417.87 |
Formula | C151H226N40O45S3 |
Cas No. | 21215-62-3 |
Relative Density. | 1.326 g/cm3 (Predicted) |
Sequence | Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7) |
Sequence Short | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge:Cys1-Cys7) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Solubility Information | H2O: 2 mg/mL (0.59 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.