Shopping Cart
Remove All
Your shopping cart is currently empty
Calciseptine, a neurotoxin isolated from the Black Mamba (Dendroaspis p. polylepis) venom, comprises 60 amino acids and is stabilized by four disulfide bonds. It specifically targets and blocks L-type calcium channels [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Backorder | Backorder | |
| 50 mg | Inquiry | Backorder | Backorder |
| Description | Calciseptine, a neurotoxin isolated from the Black Mamba (Dendroaspis p. polylepis) venom, comprises 60 amino acids and is stabilized by four disulfide bonds. It specifically targets and blocks L-type calcium channels [1]. |
| Targets&IC50 | Ca2+ channel, L-type:15 nM |
| Molecular Weight | 7036.12 |
| Formula | C299H468N90O87S10 |
| Cas No. | 178805-91-9 |
| Sequence | Arg-Ile-Cys-Tyr-Ile-His-Lys-Ala-Ser-Leu-Pro-Arg-Ala-Thr-Lys-Thr-Cys-Val-Glu-Asn-Thr-Cys-Tyr-Lys-Met-Phe-Ile-Arg-Thr-Gln-Arg-Glu-Tyr-Ile-Ser-Glu-Arg-Gly-Cys-Gly-Cys-Pro-Thr-Ala-Met-Trp-Pro-Tyr-Gln-Thr-Glu-Cys-Cys-Lys-Gly-Asp-Arg-Cys-Asn-Lys (Disulfide brid |
| Sequence Short | RICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52; Cys53-Cys58) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.