Shopping Cart
- Remove All
- Your shopping cart is currently empty
Calcicludine, a protein toxin derived from the green mamba (Dendroaspis angusticeps) venom, selectively inhibits high-voltage-activated, particularly L-type, calcium channels with an IC50 of 88 nM and plays a role in excitatory synaptic transmission [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Calcicludine, a protein toxin derived from the green mamba (Dendroaspis angusticeps) venom, selectively inhibits high-voltage-activated, particularly L-type, calcium channels with an IC50 of 88 nM and plays a role in excitatory synaptic transmission [1] [2]. |
Targets&IC50 | Ca2+ channel, L-type:88 nM |
Molecular Weight | 6980.13 |
Formula | C321H476N86O78S6 |
Cas No. | 178036-64-1 |
Sequence | Trp-Gln-Pro-Pro-Trp-Tyr-Cys-Lys-Glu-Pro-Val-Arg-Ile-Gly-Ser-Cys-Lys-Lys-Gln-Phe-Ser-Ser-Phe-Tyr-Phe-Lys-Trp-Thr-Ala-Lys-Lys-Cys-Leu-Pro-Phe-Leu-Phe-Ser-Gly-Cys-Gly-Gly-Asn-Ala-Asn-Arg-Phe-Gln-Thr-Ile-Gly-Glu-Cys-Arg-Lys-Lys-Cys-Leu-Gly-Lys (Disulfide brid |
Sequence Short | WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK (Disulfide bridge: Cys7-Cys57; Cys16-Cys40; Cys32-Cys53) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.