Shopping Cart
- Remove All
- Your shopping cart is currently empty
Wild-type human myoregulin (wt hMLN) is a microprotein that inhibits the sarcoplasmic reticulum Ca²⁺ pump (SERCA), playing a crucial role in the regulation of calcium homeostasis in skeletal muscle [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Wild-type human myoregulin (wt hMLN) is a microprotein that inhibits the sarcoplasmic reticulum Ca²⁺ pump (SERCA), playing a crucial role in the regulation of calcium homeostasis in skeletal muscle [1]. |
Molecular Weight | 5194.22 |
Formula | C245H404N54O66S |
Sequence | Met-Thr-Gly-Lys-Asn-Trp-Ile-Leu-Ile-Ser-Thr-Thr-Thr-Pro-Lys-Ser-Leu-Glu-Asp-Glu-Ile-Val-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Ile-Phe-Val-Asp-Leu-Ile-Ser-Ile-Ile-Tyr-Val-Val-Ile-Thr-Ser |
Sequence Short | MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.