Shopping Cart
- Remove All
- Your shopping cart is currently empty
PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50 values of 30 nM, 600 nM, and 40 nM for the PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $130 | Backorder | |
5 mg | $396 | Backorder |
Description | PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50 values of 30 nM, 600 nM, and 40 nM for the PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. |
Molecular Weight | 4138.76 |
Formula | C184H301N56FO47S |
Relative Density. | 1.31g/cm3 |
Sequence | Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
Sequence Short | FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.