Your shopping cart is currently empty

PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50 values of 30 nM, 600 nM, and 40 nM for the PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $130 | Inquiry | Inquiry | |
| 5 mg | $396 | Inquiry | Inquiry |
| Description | PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50 values of 30 nM, 600 nM, and 40 nM for the PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. |
| Molecular Weight | 4138.76 |
| Formula | C184H301N56FO47S |
| Relative Density. | 1.31g/cm3 |
| Sequence | Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
| Sequence Short | FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.