Shopping Cart
- Remove All
Your shopping cart is currently empty
Neuropeptide Y (human) TFA, a compound implicated in Alzheimer's disease (AD), exhibits protective effects against β-Amyloid toxicity in rat cortical neurons.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $148 | Backorder | |
| 5 mg | $598 | Backorder |
| Description | Neuropeptide Y (human) TFA, a compound implicated in Alzheimer's disease (AD), exhibits protective effects against β-Amyloid toxicity in rat cortical neurons. |
| In vitro | Neuropeptide Y (human) has been shown to shield cortical neurons from the toxicity of Aβ25-35. At concentrations of 2 μM, it counteracts the harmful effects of Aβ25-35 at both 24 and 48 hours. This protective impact on neuronal survival is consistent across neurons pre-exposed to 1 μM and 0.5 μM Neuropeptide Y (human) treatments. Furthermore, pretreatment with Neuropeptide Y (29-64), amide, human (TFA), enhances NGF synthesis and release while reducing NGF mRNA levels in cortical neurons challenged with Aβ35-25[1]. |
| Relative Density. | no data available |
| Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Short | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.