Your shopping cart is currently empty

Neuropeptide Y (human) TFA, a compound implicated in Alzheimer's disease (AD), exhibits protective effects against β-Amyloid toxicity in rat cortical neurons.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $148 | Inquiry | Inquiry | |
| 5 mg | $598 | Inquiry | Inquiry |
| Description | Neuropeptide Y (human) TFA, a compound implicated in Alzheimer's disease (AD), exhibits protective effects against β-Amyloid toxicity in rat cortical neurons. |
| In vitro | Neuropeptide Y (human) has been shown to shield cortical neurons from the toxicity of Aβ25-35. At concentrations of 2 μM, it counteracts the harmful effects of Aβ25-35 at both 24 and 48 hours. This protective impact on neuronal survival is consistent across neurons pre-exposed to 1 μM and 0.5 μM Neuropeptide Y (human) treatments. Furthermore, pretreatment with Neuropeptide Y (29-64), amide, human (TFA), enhances NGF synthesis and release while reducing NGF mRNA levels in cortical neurons challenged with Aβ35-25[1]. |
| Relative Density. | no data available |
| Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Short | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.