Shopping Cart
- Remove All
- Your shopping cart is currently empty
Neuropeptide Y (3-36) (human, rat) is a metabolite of neuropeptide Y (NPY) generated by dipeptidyl peptidase-4 (DPP4) and is known as a selective Y2 receptor agonist, effectively reducing the release of norepinephrine via the Y2 receptor [1][2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | $291 | Backorder | |
10 mg | $456 | Backorder |
Description | Neuropeptide Y (3-36) (human, rat) is a metabolite of neuropeptide Y (NPY) generated by dipeptidyl peptidase-4 (DPP4) and is known as a selective Y2 receptor agonist, effectively reducing the release of norepinephrine via the Y2 receptor [1][2]. |
Molecular Weight | 4011.5 |
Formula | C175H269N53O54S |
Cas No. | 150138-78-6 |
Relative Density. | no data available |
Sequence | Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
Sequence Short | SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.