Shopping Cart
- Remove All
Your shopping cart is currently empty
Neuropeptide Y(29-64) is a 36-amino acid peptide fragment of Neuropeptide Y.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $124 | Backorder | |
| 5 mg | $498 | Backorder |
| Description | Neuropeptide Y(29-64) is a 36-amino acid peptide fragment of Neuropeptide Y. |
| Molecular Weight | 4272.7 |
| Formula | C189H284N54O58S |
| Cas No. | 303052-45-1 |
| Relative Density. | no data available |
| Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr |
| Sequence Short | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.