Your shopping cart is currently empty

GIP (22-51) human (Glucose-dependent Insulinotropic Peptide (22-51) human) is a potent pro-atherosclerotic peptide hormone composed of 30 amino acids. It activates the NF-κB signaling pathway, enhances the expression of MMP-8, and induces the expression of pro-inflammatory and pro-atherogenic proteins. Additionally, it increases intracellular free Ca2+ levels in THP-1 induced macrophages. GIP (22-51) human is useful for atherosclerosis research.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | GIP (22-51) human (Glucose-dependent Insulinotropic Peptide (22-51) human) is a potent pro-atherosclerotic peptide hormone composed of 30 amino acids. It activates the NF-κB signaling pathway, enhances the expression of MMP-8, and induces the expression of pro-inflammatory and pro-atherogenic proteins. Additionally, it increases intracellular free Ca2+ levels in THP-1 induced macrophages. GIP (22-51) human is useful for atherosclerosis research. |
| Synonyms | Glucose-dependent Insulinotropic Peptide (22-51) (human) |
| Molecular Weight | 3181.56 |
| Formula | C140H226N44O41 |
| Cas No. | 957470-49-4 |
| Smiles | C([C@@H](NC(=O)[C@H]1N(C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CN=CN2)NC([C@@H](NC(CNC([C@@H](NC(=O)[C@H]3N(C([C@@H](NC([C@@H](NC(=O)[C@H]4N(C([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC5=CC=CC=C5)NC([C@H](CC6=CN=CN6)NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CCC(O)=O)N)=O)CCCCN)=O)CCCCN)=O)CCC(O)=O)=O)=O)=O)=O)CO)=O)C)=O)CC(C)C)=O)CCC4)CO)=O)CC(C)C)=O)CCC3)[C@@H](C)C)=O)=O)CO)=O)=O)C)=O)CCCCN)=O)[C@H](C)C)=O)CO)=O)CO)=O)CCC1)CCC(N)=O)(=O)N7[C@H](C(N[C@H](C(NCC(=O)N8[C@H](C(N[C@@H](CCCNC(=N)N)C(O)=O)=O)CCC8)=O)CCCNC(=N)N)=O)CCC7 |
| Sequence | Glu-Lys-Lys-Glu-Gly-His-Phe-Ser-Ala-Leu-Pro-Ser-Leu-Pro-Val-Gly-Ser-His-Ala-Lys-Val-Ser-Ser-Pro-Gln-Pro-Arg-Gly-Pro-Arg |
| Sequence Short | EKKEGHFSALPSLPVGSHAKVSSPQPRGPR |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.