Shopping Cart
- Remove All
- Your shopping cart is currently empty
D-JNKI-1 acetate (AM-111 acetate) is a highly potent and cell-permeable peptide inhibitor of JNK.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $167 | In Stock | |
5 mg | $329 | In Stock | |
10 mg | $491 | In Stock | |
25 mg | $785 | In Stock | |
50 mg | $1,120 | In Stock | |
100 mg | $1,480 | In Stock | |
1 mL x 10 mM (in DMSO) | $1,210 | In Stock |
Description | D-JNKI-1 acetate (AM-111 acetate) is a highly potent and cell-permeable peptide inhibitor of JNK. |
Alias | D-JNKI-1 acetate(1445179-97-4 Free base), AM-111 acetate |
Molecular Weight | 3882.5 |
Formula | C166H290N66O42 |
Smiles | CC(C[C@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N1CCC[C@@H]1C(N[C@@H](C(N[C@@H](C(N2CCC[C@@H]2C(N[C@@H](C(N3CCC[C@@H]3C(N4CCC[C@@H]4C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(NCC(N)=O)=O)CCCNC(N)=N)=O)CCCCN)=O)CCCCN)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)CCC(N)=O)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)=O)=O)CCCNC(N)=N)=O)=O)CCCCN)=O)CCCNC(N)=N)=O)=O)[C@@H](O)C)=O)[C@@H](O)C)=O)CC(C)C)=O)CC(N)=O)=O)NC([C@H](NC([C@H]5CCCN5C([C@H](NC([C@@H](C(C)C)NC([C@H]6CCCN6C([C@H](NC([C@H](NC([C@H](NC([C@@H](CC(O)=O)N)=O)CCC(N)=O)=O)CO)=O)CCCNC(N)=N)=O)=O)=O)CCC(N)=O)=O)=O)Cc7ccccc7)=O)C.CC(O)=O |
Sequence | Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly |
Sequence Short | DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
Solubility Information | DMSO: 60 mg/mL (15.45 mM), Sonication is recommended. ![]() | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.