Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: XG-102, AM-111

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 50 mg | $1,140 | Inquiry | Inquiry |
| Description | D-JNKI-1 (AM-111) is a highly effective, cell-permeable peptide inhibitor. |
| In vitro | D-JNKI-1 (AM-111; 1μM-1mM) treatment can prevent neomycin-induced apoptosis and loss of hair cells. |
| In vivo | D-JNKI-1 (AM-111; 10μM) effectively prevents hair cell death and permanent hearing loss induced by neomycin ototoxicity in guinea pig cochlea mp. Local delivery of D-JNKI-1 also mitigates permanent hearing loss due to hearing trauma in a dose-dependent manner. D-JNKI-1 (0.3 mg/kg, intraperitoneal injection) reverses pathological events in rat brain mitochondria, significantly reducing cytochrome c release and PARP cleavage. Additionally, D-JNKI-1 (1 μg/kg, s.c.) substantially decreases the disease activity index and reduces CD4+ and CD8+ cell expression in mice. |
| Synonyms | XG-102, AM-111 |
| Molecular Weight | 3822.44 |
| Formula | C164H286N66O40 |
| Cas No. | 1445179-97-4 |
| Relative Density. | no data available |
| Sequence | {D-Asp}-{D-Gln}-{D-Ser}-{D-Arg}-{D-Pro}-{D-Val}-{D-Gln}-{D-Pro}-{D-Phe}-{D-Leu}-{D-Asn}-{D-Leu}-{D-Thr}-{D-Thr}-{D-Pro}-{D-Arg}-{D-Lys}-{D-Pro}-{D-Arg}-{D-Pro}-{D-Pro}-{D-Arg}-{D-Arg}-{D-Arg}-{D-Gln}-{D-Arg}-{D-Arg}-{D-Lys}-{D-Lys}-{D-Arg}-{D-Gly}-NH₂ |
| Sequence Short | DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 50 mg/mL (13.08 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.