Your shopping cart is currently empty

Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $153 | In Stock | In Stock | |
| 5 mg | $465 | In Stock | In Stock | |
| 10 mg | $624 | In Stock | In Stock | |
| 25 mg | $996 | In Stock | In Stock |
| Description | Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively. |
| Targets&IC50 | GLP1:6.9 pM(EC50), Glucagon receptor:10.2 pM(EC50) |
| Synonyms | MEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base) |
| Molecular Weight | 3788.14 |
| Formula | C169H256N42O57 |
| Relative Density. | no data available |
| Sequence | 1'-{palmtoyl-G}; {His}{Ser}{Gln}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Lys}{Ser}{Glu}{Tyr}{Leu}{Asp}{Ser}{Glu}{Arg}{Ala}{Arg}{Asp}{Phe}{Val}{Ala}{Trp}{Leu}{Glu}{Ala}{Gly}{Gly}-(Amide bridge: Ggu1-Lys10) |
| Sequence Short | 1'-{palmtoyl-G}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG(Amide bridge: Ggu1'-Lys10) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
| Solubility Information | H2O: < 0.1 mg/mL (insoluble) DMSO: 12.5 mg/mL (3.3 mM), Sonication is recommended. | ||||||||||
| In Vivo Formulation | 10% DMSO+90% Corn Oil: 1 mg/mL (0.26 mM), Sonication is recommended. Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions. | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.