Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Cotadutide acetate

🥰Excellent
Catalog No. TP1103
Alias MEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base)

Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.

Cotadutide acetate

Cotadutide acetate

🥰Excellent
Purity: 98.28%
Catalog No. TP1103Alias MEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base)
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.
Pack SizePriceAvailabilityQuantity
1 mg$153In Stock
5 mg$465In Stock
10 mg$624In Stock
25 mg$996In Stock
Add to Cart
Add to Quotation
Bulk & Custom
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Batch Information

Select Batch
Purity:98.28%
Contact us for more batch information

Resource Download

Product Introduction

Bioactivity
Description
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.
Targets&IC50
GLP1:6.9 pM(EC50), Glucagon receptor:10.2 pM(EC50)
AliasMEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base)
Chemical Properties
Molecular Weight3788.14
FormulaC169H256N42O57
Relative Density.no data available
Sequence1'-{palmtoyl-G}; {His}{Ser}{Gln}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Lys}{Ser}{Glu}{Tyr}{Leu}{Asp}{Ser}{Glu}{Arg}{Ala}{Arg}{Asp}{Phe}{Val}{Ala}{Trp}{Leu}{Glu}{Ala}{Gly}{Gly}-(Amide bridge: Ggu1-Lys10)
Sequence Short1'-{palmtoyl-G}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG(Amide bridge: Ggu1'-Lys10)
Storage & Solubility Information
Storagekeep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.
Solubility Information
H2O: < 0.1 mg/mL (insoluble)
DMSO: 12.5 mg/mL (3.30 mM), Sonication is recommended.
Solution Preparation Table
DMSO
1mg5mg10mg50mg
1 mM0.2640 mL1.3199 mL2.6398 mL13.1991 mL

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:
TargetMol | Animal experimentsFor example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。
Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSOTargetMol | reagent (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
Preparation method for in vivo formula: Take 50 μL DMSOTargetMol | reagent main solution, add 300 μLPEG300TargetMol | reagent mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2OTargetMol | reagent mix well and clarify
For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Sci Citations

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Related Tags: buy Cotadutide acetate | purchase Cotadutide acetate | Cotadutide acetate cost | order Cotadutide acetate | Cotadutide acetate chemical structure | Cotadutide acetate formula | Cotadutide acetate molecular weight