Shopping Cart
Remove All
Your shopping cart is currently empty
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $153 | In Stock | In Stock | |
| 5 mg | $465 | In Stock | In Stock | |
| 10 mg | $624 | In Stock | In Stock | |
| 25 mg | $996 | In Stock | In Stock |
| Description | Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively. |
| Targets&IC50 | Glucagon receptor:10.2 pM(EC50), GLP1:6.9 pM(EC50) |
| Synonyms | MEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base) |
| Molecular Weight | 3788.14 |
| Formula | C169H256N42O57 |
| Relative Density. | no data available |
| Sequence | 1'-{palmtoyl-G}; {His}{Ser}{Gln}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Lys}{Ser}{Glu}{Tyr}{Leu}{Asp}{Ser}{Glu}{Arg}{Ala}{Arg}{Asp}{Phe}{Val}{Ala}{Trp}{Leu}{Glu}{Ala}{Gly}{Gly}-(Amide bridge: Ggu1-Lys10) |
| Sequence Short | 1'-{palmtoyl-G}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG(Amide bridge: Ggu1'-Lys10) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
| Solubility Information | H2O: < 0.1 mg/mL (insoluble) DMSO: 12.5 mg/mL (3.3 mM), Sonication is recommended. | ||||||||||
| In Vivo Formulation | 10% DMSO+90% Corn Oil: 1 mg/mL (0.26 mM), Sonication is recommended. Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions. | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
| |||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.