Shopping Cart
- Remove All
- Your shopping cart is currently empty
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $153 | In Stock | |
5 mg | $465 | In Stock | |
10 mg | $624 | In Stock | |
25 mg | $996 | In Stock |
Description | Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively. |
Targets&IC50 | GLP1:6.9 pM(EC50), Glucagon receptor:10.2 pM(EC50) |
Synonyms | MEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base) |
Molecular Weight | 3788.14 |
Formula | C169H256N42O57 |
Relative Density. | no data available |
Sequence | 1'-{palmtoyl-G}; {His}{Ser}{Gln}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Lys}{Ser}{Glu}{Tyr}{Leu}{Asp}{Ser}{Glu}{Arg}{Ala}{Arg}{Asp}{Phe}{Val}{Ala}{Trp}{Leu}{Glu}{Ala}{Gly}{Gly}-(Amide bridge: Ggu1-Lys10) |
Sequence Short | 1'-{palmtoyl-G}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG(Amide bridge: Ggu1'-Lys10) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
Solubility Information | H2O: < 0.1 mg/mL (insoluble) DMSO: 12.5 mg/mL (3.30 mM), Sonication is recommended. | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.