Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Cotadutide acetate (Synonyms: MEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base))

Catalog No. TP1103 Copy Product Info
Purity: 98.28%
😃Good
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.

Cotadutide acetate

Copy Product Info
😃Good
Catalog No. TP1103
Synonyms MEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base)

Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.

Cotadutide acetate
Pack SizePriceUSA StockGlobal StockQuantity
1 mg$153In StockIn Stock
5 mg$465In StockIn Stock
10 mg$624In StockIn Stock
25 mg$996In StockIn Stock
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Batch Information

Select Batch
Purity:98.28%
Appearance:Solid
Color:White
Contact us for more batch information

Resource Download

Product Introduction

Bioactivity
Description
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 of 6.9 pM and 10.2 pM, respectively.
Targets&IC50
GLP1:6.9 pM(EC50), Glucagon receptor:10.2 pM(EC50)
SynonymsMEDI0382 acetate, Cotadutide acetate (1686108-82-6 Free base)
Chemical Properties
Molecular Weight3788.14
FormulaC169H256N42O57
Relative Density.no data available
Sequence1'-{palmtoyl-G}; {His}{Ser}{Gln}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Lys}{Ser}{Glu}{Tyr}{Leu}{Asp}{Ser}{Glu}{Arg}{Ala}{Arg}{Asp}{Phe}{Val}{Ala}{Trp}{Leu}{Glu}{Ala}{Gly}{Gly}-(Amide bridge: Ggu1-Lys10)
Sequence Short1'-{palmtoyl-G}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG(Amide bridge: Ggu1'-Lys10)
Storage & Solubility Information
StorageShipping with blue ice/Shipping at ambient temperature.
Solubility Information
H2O: < 0.1 mg/mL (insoluble)
DMSO: 12.5 mg/mL (3.3 mM), Sonication is recommended.
In Vivo Formulation
10% DMSO+90% Corn Oil: 1 mg/mL (0.26 mM), Sonication is recommended.
Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions.
Solution Preparation Table
DMSO
1mg5mg10mg50mg
1 mM0.2640 mL1.3199 mL2.6398 mL13.1991 mL
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density.

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experiments For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent 10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.
Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSOTargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSOTargetMol | reagent stock solution to 400 μL PEG300TargetMol | reagent and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH2OTargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Related Tags: buy Cotadutide acetate | purchase Cotadutide acetate | Cotadutide acetate cost | order Cotadutide acetate | Cotadutide acetate chemical structure | Cotadutide acetate formula | Cotadutide acetate molecular weight