Shopping Cart
- Remove All
- Your shopping cart is currently empty
Cotadutide is a dual receptor agonist that modifies the activity of glucagon and glucagon-like peptide-1 (GLP-1).
Pack Size | Price | Availability | Quantity |
---|---|---|---|
25 mg | $1,520 | 6-8 weeks | |
50 mg | $1,980 | 6-8 weeks | |
100 mg | $2,500 | 6-8 weeks |
Description | Cotadutide is a dual receptor agonist that modifies the activity of glucagon and glucagon-like peptide-1 (GLP-1). |
Molecular Weight | 2327.48 |
Formula | C102H155N23O39 |
Cas No. | 1686108-82-6 |
Sequence | 1'-{palmtoyl-Glu}; His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Lys-Ser-Glu-Tyr-Leu-Asp-Ser-Glu-Arg-Ala-Arg-Asp-Phe-Val-Ala-Trp-Leu-Glu-Ala-Gly-Gly (Amide bridge: 1'-{palmtoyl-Glu}-Lys10) |
Sequence Short | 1'-{palmtoyl-Glu}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG (Amide bridge: 1'-{palmtoyl-Glu}-Lys10) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.