Your shopping cart is currently empty

Corza6 is a potent and selective peptide inhibitor of the human voltage-gated proton channel (hHv1). It binds to the external voltage sensor domain (VSD) loop in hHv1 at a resting membrane potential (RMP) of natural hyperpolarization in mammalian cells with a Kd of approximately 1 nM. Corza6 facilitates sperm capacitation and permits sustained production of reactive oxygen species (ROS) in leukocytes (WBC).
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Corza6 is a potent and selective peptide inhibitor of the human voltage-gated proton channel (hHv1). It binds to the external voltage sensor domain (VSD) loop in hHv1 at a resting membrane potential (RMP) of natural hyperpolarization in mammalian cells with a Kd of approximately 1 nM. Corza6 facilitates sperm capacitation and permits sustained production of reactive oxygen species (ROS) in leukocytes (WBC). |
| Molecular Weight | 4704.29 |
| Formula | C203H293N55O61S7 |
| Sequence | Ser-Ser-Thr-Cys-Ile-Pro-Ser-Gly-Gln-Pro-Cys-Ala-Asp-Ser-Asp-Asp-Cys-Cys-Glu-Thr-Phe-His-Cys-Lys-Trp-Val-Phe-Phe-Thr-Ser-Lys-Phe-Met-Cys-Arg-Arg-Val-Trp-Gly-Lys-Asp (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34) |
| Sequence Short | SSTCIPSGQPCADSDDCCETFHCKWVFFTSKFMCRRVWGKD (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.