Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms:
Corza6 TFA
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Corza6 TFA is a potent and selective peptide inhibitor of the human voltage-gated proton channel (hHv1). It binds to the external voltage-sensor domain (VSD) loop of hHv1 with a dissociation constant (Kd) of approximately 1 nM under the native hyperpolarized resting membrane potential (RMP) of mammalian cells. Additionally, Corza6 TFA induces sperm capacitation and enables continuous reactive oxygen species (ROS) production in white blood cells (WBC). |
| Sequence | Ser-Ser-Thr-Cys-Ile-Pro-Ser-Gly-Gln-Pro-Cys-Ala-Asp-Ser-Asp-Asp-Cys-Cys-Glu-Thr-Phe-His-Cys-Lys-Trp-Val-Phe-Phe-Thr-Ser-Lys-Phe-Met-Cys-Arg-Arg-Val-Trp-Gly-Lys-Asp (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34) |
| Sequence Short | SSTCIPSGQPCADSDDCCETFHCKWVFFTSKFMCRRVWGKD |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.