Shopping Cart
- Remove All
- Your shopping cart is currently empty
Candidalysin is a cytolytic peptide toxin initially isolated from *Candida albicans*, exhibiting both toxic and non-toxic properties. It activates epithelial cell signaling pathways by interacting with the epithelial growth factor receptor (EGFR) on host cells, leading to the activation of matrix metalloproteinases (MMP) and calcium ion influx, which results in inflammatory responses and immune cell recruitment. Additionally, Candidalysin exhibits cytotoxicity by causing membrane damage to host cells.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Candidalysin is a cytolytic peptide toxin initially isolated from *Candida albicans*, exhibiting both toxic and non-toxic properties. It activates epithelial cell signaling pathways by interacting with the epithelial growth factor receptor (EGFR) on host cells, leading to the activation of matrix metalloproteinases (MMP) and calcium ion influx, which results in inflammatory responses and immune cell recruitment. Additionally, Candidalysin exhibits cytotoxicity by causing membrane damage to host cells. |
Molecular Weight | 3310.11 |
Formula | C153H266N38O38S2 |
Cas No. | 1906866-53-2 |
Sequence | Ser-Ile-Ile-Gly-Ile-Ile-Met-Gly-Ile-Leu-Gly-Asn-Ile-Pro-Gln-Val-Ile-Gln-Ile-Ile-Met-Ser-Ile-Val-Lys-Ala-Phe-Lys-Gly-Asn-Lys |
Sequence Short | SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.