Shopping Cart
- Remove All
- Your shopping cart is currently empty
Aviptadil (INN) is an analog of vasoactive intestinal polypeptide (VIP) for the treatment of erectile dysfunction.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $117 | 7-10 days | |
5 mg | $247 | 7-10 days | |
10 mg | $346 | 7-10 days | |
50 mg | $643 | 7-10 days |
Description | Aviptadil (INN) is an analog of vasoactive intestinal polypeptide (VIP) for the treatment of erectile dysfunction. |
Synonyms | Vasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine) |
Molecular Weight | 3325.8 |
Formula | C147H238N44O42S |
Cas No. | 40077-57-4 |
Relative Density. | 1.47 g/cm3 (Predicted) |
Sequence Short | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
Solubility Information | H2O: 65 mg/mL (19.54 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.