Shopping Cart
- Remove All
Your shopping cart is currently empty
Urotensin I (Catostomus urotensin I) TFA is a CRF-like neuropeptide that acts as an agonist for CRF receptors, with pEC50 values of 11.46 for human CRF1, 9.36 for human CRF2, and 9.85 for rat CRF2α receptors in CHO cells. It shows binding affinities (Ki) of 0.4 nM for hCRF1, 1.8 nM for rCRF2α, and 5.7 nM for mCRF2β receptors [1] [2].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Urotensin I (Catostomus urotensin I) TFA is a CRF-like neuropeptide that acts as an agonist for CRF receptors, with pEC50 values of 11.46 for human CRF1, 9.36 for human CRF2, and 9.85 for rat CRF2α receptors in CHO cells. It shows binding affinities (Ki) of 0.4 nM for hCRF1, 1.8 nM for rCRF2α, and 5.7 nM for mCRF2β receptors [1] [2]. |
| Molecular Weight | 4983.48 |
| Formula | C212H341F3N62O69S2 |
| Sequence | Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 |
| Sequence Short | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.