Shopping Cart
- Remove All
Your shopping cart is currently empty
Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively. Urotensin-I was first isolated from the urophysis of the white sucker, and has been shown to decrease blood pressure in the rat. UI consists of 41 aa residues with an amidated C-terminus.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $369 | Backorder | |
| 5 mg | $1,116 | Backorder |
| Description | Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively. Urotensin-I was first isolated from the urophysis of the white sucker, and has been shown to decrease blood pressure in the rat. UI consists of 41 aa residues with an amidated C-terminus. |
| Synonyms | Catostomus urotensin I |
| Molecular Weight | 4869.46 |
| Formula | C210H340N62O67S2 |
| Cas No. | 83930-33-0 |
| Relative Density. | 1.31g/cm3 |
| Sequence | Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 |
| Sequence Short | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.