Shopping Cart
- Remove All
- Your shopping cart is currently empty
Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $148 | In Stock | |
5 mg | $497 | In Stock | |
10 mg | $747 | In Stock | |
25 mg | $1,342 | In Stock | |
50 mg | $1,997 | In Stock |
Description | Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary. |
In vitro | Corticotropin-releasing factor (human) acetate caused pain-induced aversive responses through the increase of excitability of type II dlBNST neurons and the activation of the AC-cAMP-PKA pathway[2]. |
In vivo | The time spent in the drug-paired compartment during the test session (314±22 s) is significantly shorter than the time spent in that compartment during the preconditioning session (520±18 s) in rats injected with Corticotropin-releasing factor (human) acetate (1 nmol/side)[2]. |
Synonyms | Corticotropin-releasing factor (human) acetate (86784-80-7 Free base) |
Relative Density. | no data available |
Sequence | Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile |
Sequence Short | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.