Shopping Cart
Remove All
Your shopping cart is currently empty
Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $148 | - | In Stock | |
| 5 mg | $497 | - | In Stock | |
| 10 mg | $747 | - | In Stock | |
| 25 mg | $1,342 | - | In Stock | |
| 50 mg | $1,997 | - | In Stock |
| Description | Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary. |
| In vitro | Corticotropin-releasing factor (human) acetate caused pain-induced aversive responses through the increase of excitability of type II dlBNST neurons and the activation of the AC-cAMP-PKA pathway[2]. |
| In vivo | The time spent in the drug-paired compartment during the test session (314±22 s) is significantly shorter than the time spent in that compartment during the preconditioning session (520±18 s) in rats injected with Corticotropin-releasing factor (human) acetate (1 nmol/side)[2]. |
| Synonyms | Corticotropin-releasing factor (human) acetate (86784-80-7 Free base) |
| Relative Density. | no data available |
| Sequence | Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile |
| Sequence Short | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.