Your shopping cart is currently empty

Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $148 | - | In Stock | |
| 5 mg | $497 | - | In Stock | |
| 10 mg | $747 | - | In Stock | |
| 25 mg | $1,342 | - | In Stock | |
| 50 mg | $1,997 | - | In Stock |
| Description | Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary. |
| In vitro | Corticotropin-releasing factor (human) acetate caused pain-induced aversive responses through the increase of excitability of type II dlBNST neurons and the activation of the AC-cAMP-PKA pathway[2]. |
| In vivo | The time spent in the drug-paired compartment during the test session (314±22 s) is significantly shorter than the time spent in that compartment during the preconditioning session (520±18 s) in rats injected with Corticotropin-releasing factor (human) acetate (1 nmol/side)[2]. |
| Synonyms | Corticotropin-releasing factor (human) acetate (86784-80-7 Free base) |
| Relative Density. | no data available |
| Sequence | Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile |
| Sequence Short | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.