Shopping Cart

Your shopping cart is currently empty

Urotensin I acetate (83930-33-0 Free base)

Name: Urotensin I acetate (83930-33-0 Free base)
Brand: TargetMol
SKU: TP1199L
Price: 250 USD
Availability: InStock
Rating: 5 (10 reviews)

Copy Product Info

🥰Excellent

Synonyms:

Catalog No. TP1199L Copy Product Info

Purity: 99.73%

🥰Excellent

Urotensin I acetate (83930-33-0 Free base) is a CRF-like neuropeptide (natural product), a CRF receptor agonist (EC50 as low as 3.5 pM for hCRF1, Ki=0.4 nM), with high affinity and receptor subtype selectivity, used for CRF receptor functional research.

Pack Size	Price	USA Stock	Global Stock
1 mg	$250	-	In Stock
5 mg	$592	-	In Stock
10 mg	$798	-	In Stock
25 mg	$1,180	-	In Stock
50 mg	$1,590	-	In Stock
100 mg	$2,150	-	In Stock

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:99.73%

Appearance:Solid

Color:White

Resource Download

COA MS HPLC

Product Introduction

Bioactivity

Description	Urotensin I acetate (83930-33-0 Free base) is a CRF-like neuropeptide (natural product), a CRF receptor agonist (EC50 as low as 3.5 pM for hCRF1, Ki=0.4 nM), with high affinity and receptor subtype selectivity, used for CRF receptor functional research.
Targets & IC50	CRF2α (rat) (cell assay):1.8 nM (Ki), CRF2 (human, CHO cells):9.36 (pEC50), CRF1 (human, CHO cells):11.46 (pEC50), CRF2α (rat, CHO cells):9.85 (pEC50), CRF1 (human):0.4 nM (Ki), mCRF2β (cell assay):5.7 nM (Ki)
In vitro	Methods: Using a goldfish anterior pituitary cell column, the stimulatory effect of Urotensin I acetate (83930-33-0 Free base) on ACTH release was measured and compared with CRF and sauvagine. Results: Urotensin I acetate was 2-3 times more potent than CRF or sauvagine in stimulating ACTH release.[1] Methods: Rat tail artery strips were incubated in medium containing 4×10⁻³ M theophylline and treated with Urotensin I acetate at concentrations of 0.75, 1.50, and 7.50 mU/ml to detect changes in cAMP content. Results: Urotensin I acetate at 1.50 and 7.50 mU/ml significantly increased cAMP content, while the 0.75 mU/ml concentration had no significant effect.[2]
In vivo	Methods: Using a goldfish model with endogenous ACTH secretion suppressed by betamethasone, Urotensin I acetate (83930-33-0 Free base), ovine CRF, and sauvagine were administered via intraperitoneal injection to detect changes in plasma cortisol levels. Results: Urotensin I acetate, ovine CRF, and sauvagine all significantly increased plasma cortisol levels in goldfish.[1]

Chemical Properties

Smiles	CC[C@@H]([C@H](NC([C@@H](NC([C@@H](NC([C@@H](N)CCSC)=O)C)=O)CCCNC(N)=N)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)C(C)C)=O)CCC(O)=O)=O)CC(O)=O)=O)CC(C)C)=O)CC1=CC=C(O)C=C1)=O)CCCCN)=O)CCCNC(N)=N)=O)CC(N)=O)=O)CC(C)C)=O)=O)C)=O)CCC(N)=O)=O)CCC(O)=O)=O)CCCNC(N)=N)=O)CCC(O)=O)=O)CC(N)=O)=O)CCC(O)=O)=O)C.O=C(C)O
Sequence	Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val
Sequence Short	NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV

Storage & Solubility Information

Storage

Keep away from moisture,Store at low temperature Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 µL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 µL Tween 80 and mix well until fully clarified.

3) Add 450 µL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Urotensin I acetate (83930330 Free base)Urotensin I acetate (83930 33 0 Free base)Urotensin I AcetateCRF83930-33-0 Free base83930-33-0

Related Tags: Urotensin I acetate (83930-33-0 Free base) chemical structure | Urotensin I acetate (83930-33-0 Free base) in vivo | Urotensin I acetate (83930-33-0 Free base) in vitro