Your shopping cart is currently empty

Urotensin I acetate, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively[1][2].

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $250 | - | In Stock | |
| 5 mg | $592 | - | In Stock | |
| 10 mg | $798 | - | In Stock | |
| 25 mg | $1,180 | - | In Stock | |
| 50 mg | $1,590 | - | In Stock | |
| 100 mg | $2,150 | - | In Stock |
| Description | Urotensin I acetate, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively[1][2]. |
| Targets&IC50 | CRF2α (rat, CHO cells):9.85 (pEC50), CRF2α (rat) (cell assay):1.8 nM (Ki), CRF1 (human):0.4 nM (Ki), CRF2 (human, CHO cells):9.36 (pEC50), CRF1 (human, CHO cells):11.46 (pEC50), mCRF2β (cell assay):5.7 nM (Ki) |
| In vitro | Urotensin I acetate is 2-3 times more potent than CRF or sauvagine in stimulating ACTH release from a superfused goldfish anterior pituitary cell column[3]. Rat tail artery strips were incubated in the presence of 4 x 10(-3) M theophylline and Urotensin I acetate. At the concentrations of 1.50, 7.50 mU/ml but not of 0.75 mU/ml Urotensin I acetate, the content of cAMP increased significantly[4]. |
| In vivo | Intraperitoneal injections of urotensin I acetate, a CRF-like neuropeptide isolated from the caudal neurosecretory system of the teleost Catostomus commersoni, ovine CRF and sauvagine all produced significant increases in circulating levels of plasma cortisol in goldfish in which endogenous ACTH secretion was suppressed with betamethasone[3] |
| Smiles | CC[C@@H]([C@H](NC([C@@H](NC([C@@H](NC([C@@H](N)CCSC)=O)C)=O)CCCNC(N)=N)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)C(C)C)=O)CCC(O)=O)=O)CC(O)=O)=O)CC(C)C)=O)CC1=CC=C(O)C=C1)=O)CCCCN)=O)CCCNC(N)=N)=O)CC(N)=O)=O)CC(C)C)=O)=O)C)=O)CCC(N)=O)=O)CCC(O)=O)=O)CCCNC(N)=N)=O)CCC(O)=O)=O)CC(N)=O)=O)CCC(O)=O)=O)C.O=C(C)O |
| Sequence | Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val |
| Sequence Short | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.