Shopping Cart
Remove All
Your shopping cart is currently empty
Urotensin I acetate, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively[1][2].

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $250 | In Stock | In Stock | |
| 5 mg | $592 | In Stock | In Stock | |
| 10 mg | $798 | - | In Stock | |
| 25 mg | $1,180 | - | In Stock | |
| 50 mg | $1,590 | - | In Stock | |
| 100 mg | $2,150 | - | In Stock |
| Description | Urotensin I acetate, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively[1][2]. |
| Targets&IC50 | CRF2α (rat) (cell assay):1.8 nM (Ki), CRF2 (human, CHO cells):9.36 (pEC50), CRF2α (rat, CHO cells):9.85 (pEC50), CRF1 (human, CHO cells):11.46 (pEC50), mCRF2β (cell assay):5.7 nM (Ki), CRF1 (human):0.4 nM (Ki) |
| In vitro | Urotensin I acetate is 2-3 times more potent than CRF or sauvagine in stimulating ACTH release from a superfused goldfish anterior pituitary cell column[3]. Rat tail artery strips were incubated in the presence of 4 x 10(-3) M theophylline and Urotensin I acetate. At the concentrations of 1.50, 7.50 mU/ml but not of 0.75 mU/ml Urotensin I acetate, the content of cAMP increased significantly[4]. |
| In vivo | Intraperitoneal injections of urotensin I acetate, a CRF-like neuropeptide isolated from the caudal neurosecretory system of the teleost Catostomus commersoni, ovine CRF and sauvagine all produced significant increases in circulating levels of plasma cortisol in goldfish in which endogenous ACTH secretion was suppressed with betamethasone[3] |
| Smiles | CC[C@@H]([C@H](NC([C@@H](NC([C@@H](NC([C@@H](N)CCSC)=O)C)=O)CCCNC(N)=N)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)C(C)C)=O)CCC(O)=O)=O)CC(O)=O)=O)CC(C)C)=O)CC1=CC=C(O)C=C1)=O)CCCCN)=O)CCCNC(N)=N)=O)CC(N)=O)=O)CC(C)C)=O)=O)C)=O)CCC(N)=O)=O)CCC(O)=O)=O)CCCNC(N)=N)=O)CCC(O)=O)=O)CC(N)=O)=O)CCC(O)=O)=O)C.O=C(C)O |
| Color | White |
| Appearance | Solid |
| Sequence | Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val |
| Sequence Short | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV |
| Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.