Shopping Cart
- Remove All
- Your shopping cart is currently empty
Teduglutide acetate, a GLP-2 analogue, maximizes small intestinal mucosal hypertrophy. Teduglutide acetate partially restores small intestinal epithelial function through an altered distribution of claudin-10, facilitating sodium recirculation for Na-coupled glucose transport and water absorption.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $112 | In Stock | |
5 mg | $229 | In Stock | |
10 mg | $367 | In Stock | |
25 mg | $619 | In Stock | |
50 mg | $879 | In Stock | |
100 mg | $1,190 | In Stock |
Description | Teduglutide acetate, a GLP-2 analogue, maximizes small intestinal mucosal hypertrophy. Teduglutide acetate partially restores small intestinal epithelial function through an altered distribution of claudin-10, facilitating sodium recirculation for Na-coupled glucose transport and water absorption. |
In vivo | Teduglutide acetate reduced intestinal failure incidence in Nod2 k.o. mice. In wt mice, Teduglutide acetate attenuated intestinal insufficiency as indicated by reduced body weight loss and lower plasma aldosterone concentrations, lower stool water content, and lower stool sodium losses. Teduglutide acetate treatment was associated with enhanced epithelial paracellular pore function and enhanced claudin-10 expression in tight junctions in the villus tips, where it colocalized with sodium-glucose cotransporter 1 (SGLT-1), which mediates Na-coupled glucose transport[1]. |
Relative Density. | no data available |
Sequence | His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
Sequence Short | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | DMSO: 1 mg/mL, Sonication is recommended. ![]() |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.