Your shopping cart is currently empty

Teduglutide acetate, a GLP-2 analogue, maximizes small intestinal mucosal hypertrophy. Teduglutide acetate partially restores small intestinal epithelial function through an altered distribution of claudin-10, facilitating sodium recirculation for Na-coupled glucose transport and water absorption.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $112 | In Stock | In Stock | |
| 5 mg | $229 | In Stock | In Stock | |
| 10 mg | $367 | In Stock | In Stock | |
| 25 mg | $619 | In Stock | In Stock | |
| 50 mg | $879 | In Stock | In Stock | |
| 100 mg | $1,190 | In Stock | - |
| Description | Teduglutide acetate, a GLP-2 analogue, maximizes small intestinal mucosal hypertrophy. Teduglutide acetate partially restores small intestinal epithelial function through an altered distribution of claudin-10, facilitating sodium recirculation for Na-coupled glucose transport and water absorption. |
| In vivo | Teduglutide acetate reduced intestinal failure incidence in Nod2 k.o. mice. In wt mice, Teduglutide acetate attenuated intestinal insufficiency as indicated by reduced body weight loss and lower plasma aldosterone concentrations, lower stool water content, and lower stool sodium losses. Teduglutide acetate treatment was associated with enhanced epithelial paracellular pore function and enhanced claudin-10 expression in tight junctions in the villus tips, where it colocalized with sodium-glucose cotransporter 1 (SGLT-1), which mediates Na-coupled glucose transport[1]. |
| Relative Density. | no data available |
| Sequence | His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
| Sequence Short | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | DMSO: 1 mg/mL, Sonication is recommended. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.