Shopping Cart
- Remove All
- Your shopping cart is currently empty
Teduglutide TFA, a dipeptidyl peptidase IV-resistant glucagon-like peptide-2 (GLP-2) analogue, exhibits trophic effects on the gut mucosa and is used in research related to short bowel syndrome (SBS) and Crohn's disease (CD) [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Teduglutide TFA, a dipeptidyl peptidase IV-resistant glucagon-like peptide-2 (GLP-2) analogue, exhibits trophic effects on the gut mucosa and is used in research related to short bowel syndrome (SBS) and Crohn's disease (CD) [1] [2]. |
Synonyms | ALX-0600 TFA |
Sequence Short | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.