Your shopping cart is currently empty

Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption by promoting mucosal growth and reducing mucosal degradation, improving intestinal recovery. It is used in the study of short bowel syndrome (SBS). Teduglutide activates NR4a1/nur77 expression and FXR signaling, alleviating intestinal dysfunction in mice and improving lung injury, making it useful for studying metabolic and cardiovascular diseases.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $77 | In Stock | In Stock | |
| 5 mg | $183 | In Stock | In Stock | |
| 10 mg | $286 | In Stock | In Stock | |
| 25 mg | $522 | In Stock | In Stock | |
| 50 mg | $756 | In Stock | In Stock | |
| 100 mg | $987 | In Stock | - | |
| 200 mg | $1,390 | 7-10 days | 7-10 days |
| Description | Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption by promoting mucosal growth and reducing mucosal degradation, improving intestinal recovery. It is used in the study of short bowel syndrome (SBS). Teduglutide activates NR4a1/nur77 expression and FXR signaling, alleviating intestinal dysfunction in mice and improving lung injury, making it useful for studying metabolic and cardiovascular diseases. |
| In vitro | Teduglutide (2.5 μM, 36 h) can activate the expression of NR4a1/nur77 in human hepatic stellate cells. [1] Teduglutide increased the proliferation and decreased apoptosis of all intestinal epithelial cells in the short intestinal neonatal piglet model. [2] |
| In vivo | Liver inflammation, fibrosis, and reactive bile duct cell phenotypes were improved in Mdr2 mice treated with Teduglutide (intraperitoneal injection). Teduglutide promotes Fxr-Fgf15/19 signaling in the gut, resulting in decreased Cyp7a1 and increased Cyp2c70 expression in the liver, contributing to the hepatoprotective and antifibrotic effects of GLP-2 in Mdr2-/- mouse models. [1] Teduglutide (0.1 mg/kg/d) improved mucosal surface area and acute nutrient handling capacity of newborn piglets with ileojejunal resection. [2] |
| Synonyms | TAK633, TAK 633, Revestive, Gattex, ALX-0600, ALX0600 |
| Molecular Weight | 3752.08 |
| Formula | C164H252N44O55S |
| Cas No. | 197922-42-2 |
| Sequence | H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH |
| Sequence Short | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Storage | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | DMSO: 40 mg/mL (10.66 mM), Sonication is recommended. H2O: 10 mg/mL (2.67 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O/DMSO
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | ||||||||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.