Shopping Cart
- Remove All
Your shopping cart is currently empty
Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption by promoting mucosal growth and reducing mucosal degradation, improving intestinal recovery. It is used in the study of short bowel syndrome (SBS). Teduglutide activates NR4a1/nur77 expression and FXR signaling, alleviating intestinal dysfunction in mice and improving lung injury, making it useful for studying metabolic and cardiovascular diseases.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $77 | In Stock | |
| 5 mg | $183 | In Stock | |
| 10 mg | $286 | In Stock | |
| 25 mg | $522 | In Stock | |
| 50 mg | $756 | In Stock | |
| 100 mg | $987 | In Stock | |
| 200 mg | $1,390 | In Stock |
| Description | Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption by promoting mucosal growth and reducing mucosal degradation, improving intestinal recovery. It is used in the study of short bowel syndrome (SBS). Teduglutide activates NR4a1/nur77 expression and FXR signaling, alleviating intestinal dysfunction in mice and improving lung injury, making it useful for studying metabolic and cardiovascular diseases. |
| In vitro | Teduglutide (2.5 μM, 36 h) can activate the expression of NR4a1/nur77 in human hepatic stellate cells. [1] Teduglutide increased the proliferation and decreased apoptosis of all intestinal epithelial cells in the short intestinal neonatal piglet model. [2] |
| In vivo | Liver inflammation, fibrosis, and reactive bile duct cell phenotypes were improved in Mdr2 mice treated with Teduglutide (intraperitoneal injection). Teduglutide promotes Fxr-Fgf15/19 signaling in the gut, resulting in decreased Cyp7a1 and increased Cyp2c70 expression in the liver, contributing to the hepatoprotective and antifibrotic effects of GLP-2 in Mdr2-/- mouse models. [1] Teduglutide (0.1 mg/kg/d) improved mucosal surface area and acute nutrient handling capacity of newborn piglets with ileojejunal resection. [2] |
| Synonyms | TAK633, TAK 633, Revestive, Gattex, ALX-0600, ALX0600 |
| Molecular Weight | 3752.08 |
| Formula | C164H252N44O55S |
| Cas No. | 197922-42-2 |
| Color | White |
| Appearance | Solid |
| Sequence Short | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | DMSO: 40 mg/mL (10.66 mM), Sonication is recommended. H2O: 10 mg/mL (2.67 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O/DMSO
DMSO
| ||||||||||||||||||||||||||

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.