Shopping Cart

Your shopping cart is currently empty

Teduglutide

Name: Teduglutide
Brand: TargetMol
SKU: T35337
Price: 77 USD
Availability: InStock
Rating: 5 (10 reviews)

Copy Product Info

😃Good

Catalog No. T35337Cas No. 197922-42-2

Alias TAK633, TAK 633, Revestive, Gattex, ALX-0600, ALX0600

Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption by promoting mucosal growth and reducing mucosal degradation, improving intestinal recovery. It is used in the study of short bowel syndrome (SBS). Teduglutide activates NR4a1/nur77 expression and FXR signaling, alleviating intestinal dysfunction in mice and improving lung injury, making it useful for studying metabolic and cardiovascular diseases.

Teduglutide

Copy Product Info

😃Good

Purity: 98.08%

Catalog No. T35337Alias TAK633, TAK 633, Revestive, Gattex, ALX-0600, ALX0600Cas No. 197922-42-2

Pack Size	Price	USA Warehouse	Global Warehouse
1 mg	$77	In Stock	In Stock
5 mg	$183	In Stock	In Stock
10 mg	$286	In Stock	In Stock
25 mg	$522	In Stock	In Stock
50 mg	$756	In Stock	In Stock
100 mg	$987	In Stock	-
200 mg	$1,390	7-10 days	7-10 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Batch Information

Select Batch

Purity:98.08%

Appearance:Solid

Color:White

Resource Download

COA HPLC MS

Product Introduction

Bioactivity

Description	Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption by promoting mucosal growth and reducing mucosal degradation, improving intestinal recovery. It is used in the study of short bowel syndrome (SBS). Teduglutide activates NR4a1/nur77 expression and FXR signaling, alleviating intestinal dysfunction in mice and improving lung injury, making it useful for studying metabolic and cardiovascular diseases.
In vitro	Teduglutide (2.5 μM, 36 h) can activate the expression of NR4a1/nur77 in human hepatic stellate cells. [1] Teduglutide increased the proliferation and decreased apoptosis of all intestinal epithelial cells in the short intestinal neonatal piglet model. [2]
In vivo	Liver inflammation, fibrosis, and reactive bile duct cell phenotypes were improved in Mdr2 mice treated with Teduglutide (intraperitoneal injection). Teduglutide promotes Fxr-Fgf15/19 signaling in the gut, resulting in decreased Cyp7a1 and increased Cyp2c70 expression in the liver, contributing to the hepatoprotective and antifibrotic effects of GLP-2 in Mdr2-/- mouse models. [1] Teduglutide (0.1 mg/kg/d) improved mucosal surface area and acute nutrient handling capacity of newborn piglets with ileojejunal resection. [2]
Synonyms	TAK633, TAK 633, Revestive, Gattex, ALX-0600, ALX0600

Chemical Properties

Molecular Weight	3752.08
Formula	C₁₆₄H₂₅₂N₄₄O₅₅S
Cas No.	197922-42-2
Sequence	H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Sequence Short	HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Storage & Solubility Information

Storage

keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

DMSO: 40 mg/mL (10.66 mM), Sonication is recommended.

H2O: 10 mg/mL (2.67 mM), Sonication is recommended.

Solution Preparation Table

H2O/DMSO

	1mg	5mg	10mg	50mg
1 mM	0.2665 mL	1.3326 mL	2.6652 mL	13.3259 mL

DMSO

	1mg	5mg	10mg	50mg
5 mM	0.0533 mL	0.2665 mL	0.5330 mL	2.6652 mL
10 mM	0.0267 mL	0.1333 mL	0.2665 mL	1.3326 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc