Shopping Cart
- Remove All
- Your shopping cart is currently empty
SPAI-1, a peptide isolated from porcine duodenum, serves as a specific inhibitor to monovalent cation transporting ATPases, effectively inhibiting Na+, K+-ATPase and H+, K+-ATPase while stimulating Mg2+-ATPase in vitro [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | SPAI-1, a peptide isolated from porcine duodenum, serves as a specific inhibitor to monovalent cation transporting ATPases, effectively inhibiting Na+, K+-ATPase and H+, K+-ATPase while stimulating Mg2+-ATPase in vitro [1] [2]. |
Molecular Weight | 5628.57 |
Formula | C245H386N72O65S8 |
Cas No. | 131359-77-8 |
Sequence Short | LLSKRGHCPRILFRCPLSNPSNKCWRDYDCPGVKKCCEGFCGKDCLYPK (Disulfide bridge:Cys8-Cys37,Cys15-Cys41,Cys24-Cys36,Cys30-Cys45) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.