Shopping Cart
- Remove All
- Your shopping cart is currently empty
Psalmotoxin 1 is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Psalmotoxin 1 is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker. |
Synonyms | Psalmopoeus cambridgei toxin-1, PcTx1 |
Molecular Weight | 4689.41 |
Formula | C200H312N62O57S6 |
Cas No. | 880107-52-8 |
Relative Density. | no data available |
Sequence | Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33) |
Sequence Short | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.