Shopping Cart
Remove All
Your shopping cart is currently empty
Psalmotoxin 1 is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | Psalmotoxin 1 is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker. |
| Synonyms | Psalmopoeus cambridgei toxin-1, PcTx1 |
| Molecular Weight | 4689.41 |
| Formula | C200H312N62O57S6 |
| Cas No. | 880107-52-8 |
| Smiles | CC[C@@H]([C@H](NC([C@@H](NC([C@@H](NC([C@@H](N)CCC(O)=O)=O)CC(O)=O)=O)CS)=O)C(N1CCC[C@H]1C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N2CCC[C@H]2C(N[C@H](C(N[C@H](C(N3CCC[C@H]3C(N[C@H](C(N[C@H](C(O)=O)[C@H](O)C)=O)CCCCN)=O)=O)[C@H](O)C)=O)CCCCN)=O)=O)C(C)C)=O)CS)=O)C(C)C)=O)CCC(O)=O)=O)CC4=CC=CC=C4)=O)CO)=O)CCC/N=C(N)\N)=O)CCC/N=C(N)\N)=O)CCC/N=C(N)\N)=O)CCCCN)=O)CC5=CNC6=CC=CC=C65)=O)CS)=O)CCC(O)=O)=O)CC(C)C)=O)=O)CCC(O)=O)=O)CS)=O)CS)=O)CC(O)=O)=O)=O)CC7=CNC=N7)=O)CCC/N=C(N)\N)=O)CC(N)=O)=O)C(C)C)=O)CS)=O)=O)CCCCN)=O)CC8=CNC9=CC=CC=C98)=O)CCCCN)=O)=O)C |
| Relative Density. | no data available |
| Sequence | Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33) |
| Sequence Short | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.