Shopping Cart
Remove All
Your shopping cart is currently empty
Pramlintide acetate, a polypeptide analogue of human amylin, functions as an antidiabetic agent and exhibits antineoplastic activity in colorectal cancer.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $36 | In Stock | In Stock | |
| 5 mg | $88 | In Stock | In Stock | |
| 10 mg | $137 | In Stock | In Stock | |
| 25 mg | $298 | In Stock | In Stock | |
| 50 mg | $433 | In Stock | In Stock | |
| 100 mg | $592 | In Stock | In Stock | |
| 200 mg | $783 | - | In Stock |
| Description | Pramlintide acetate, a polypeptide analogue of human amylin, functions as an antidiabetic agent and exhibits antineoplastic activity in colorectal cancer. |
| In vitro | Pramlintide inhibited the growth of HCT-116 and HT-29 in a dose-dependent manner, with higher efficacy against the latter (IC50s; 48.67 and 9.10 μg/mL, respectively;?p-value =0.013). Moreover, the addition of 5, 10, and 20 μg/mL of pramlintide to HCT-116 and HT-29 with 5-fluorouracil, oxaliplatin, or irinotecan induced the antiproliferative effect synergistically (R>1.6,?p-value <0.05). |
| Molecular Weight | 4009 |
| Formula | C173H271N51O55S2 |
| Cas No. | 187887-46-3 |
| Smiles | CC[C@@H]([C@H](NC([C@@H]1CCCN1C(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H]2CSSC[C@H](NC([C@@H](N)CCCCN)=O)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](C)C(N[C@@H]([C@H](O)C)C(N2)=O)=O)=O)=O)=O)=O)C)=O)[C@H](O)C)=O)CCC(N)=O)=O)CCCNC(N)=N)=O)CC(C)C)=O)C)=O)CC(N)=O)=O)CC3=CC=CC=C3)=O)CC(C)C)=O)C(C)C)=O)CC4=CNC=N4)=O)CO)=O)CO)=O)CC(N)=O)=O)CC(N)=O)=O)CC5=CC=CC=C5)=O)=O)=O)C(N[C@H](C(N6CCC[C@H]6C(N7CCC[C@H]7C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)CC8=CC=C(O)C=C8)=O)[C@H](O)C)=O)CC(N)=O)=O)CO)=O)=O)C(C)C)=O)CC(N)=O)=O)[C@H](O)C)=O)=O)=O)CC(C)C)=O)C.CC(O)=O |
| Relative Density. | no data available |
| Color | White |
| Appearance | Solid |
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-NH2 (Disulfide bridge:Cys2-Cys7) |
| Sequence Short | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | DMSO: 10 mM | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
| |||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.