Your shopping cart is currently empty

Pramlintide acetate, a polypeptide analogue of human amylin, functions as an antidiabetic agent and exhibits antineoplastic activity in colorectal cancer.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $36 | In Stock | In Stock | |
| 5 mg | $88 | In Stock | In Stock | |
| 10 mg | $137 | In Stock | In Stock | |
| 25 mg | $298 | In Stock | In Stock | |
| 50 mg | $433 | In Stock | In Stock | |
| 100 mg | $592 | In Stock | In Stock | |
| 200 mg | $783 | - | In Stock |
| Description | Pramlintide acetate, a polypeptide analogue of human amylin, functions as an antidiabetic agent and exhibits antineoplastic activity in colorectal cancer. |
| In vitro | Pramlintide inhibited the growth of HCT-116 and HT-29 in a dose-dependent manner, with higher efficacy against the latter (IC50s; 48.67 and 9.10 μg/mL, respectively;?p-value =0.013). Moreover, the addition of 5, 10, and 20 μg/mL of pramlintide to HCT-116 and HT-29 with 5-fluorouracil, oxaliplatin, or irinotecan induced the antiproliferative effect synergistically (R>1.6,?p-value <0.05). |
| Molecular Weight | 4009 |
| Formula | C173H271N51O55S2 |
| Cas No. | 187887-46-3 |
| Smiles | CC[C@@H]([C@H](NC([C@@H]1CCCN1C(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H]2CSSC[C@H](NC([C@@H](N)CCCCN)=O)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](C)C(N[C@@H]([C@H](O)C)C(N2)=O)=O)=O)=O)=O)=O)C)=O)[C@H](O)C)=O)CCC(N)=O)=O)CCCNC(N)=N)=O)CC(C)C)=O)C)=O)CC(N)=O)=O)CC3=CC=CC=C3)=O)CC(C)C)=O)C(C)C)=O)CC4=CNC=N4)=O)CO)=O)CO)=O)CC(N)=O)=O)CC(N)=O)=O)CC5=CC=CC=C5)=O)=O)=O)C(N[C@H](C(N6CCC[C@H]6C(N7CCC[C@H]7C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)CC8=CC=C(O)C=C8)=O)[C@H](O)C)=O)CC(N)=O)=O)CO)=O)=O)C(C)C)=O)CC(N)=O)=O)[C@H](O)C)=O)=O)=O)CC(C)C)=O)C.CC(O)=O |
| Relative Density. | no data available |
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-NH2 (Disulfide bridge:Cys2-Cys7) |
| Sequence Short | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY (Disulfide bridge:Cys2-Cys7) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | DMSO: 10 mM | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.