Shopping Cart
Remove All
Your shopping cart is currently empty
Pramlintide, a polypeptide analog of human amylin, is an antidiabetic agent with antineoplastic properties in colorectal cancer.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 500 μg | $1,070 | 35 days | 35 days |
| Description | Pramlintide, a polypeptide analog of human amylin, is an antidiabetic agent with antineoplastic properties in colorectal cancer. |
| In vitro | Pramlintide demonstrates dose-dependent inhibition of HCT-116 and HT-29 cell proliferation, showing greater effectiveness against HT-29 (IC 50 values are 48.67 and 9.10 μg/mL, respectively)[1]. Co-administration of Pramlintide at concentrations of 5, 10, and 20 μg/mL with 5-fluorouracil, Oxaliplatin, or Irinotecan enhances the antiproliferative effect synergistically in both HCT-116 and HT-29 cells[1]. |
| Cas No. | 151126-32-8 |
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) |
| Sequence Short | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.