Your shopping cart is currently empty

Pramlintide, a polypeptide analog of human amylin, is an antidiabetic agent with antineoplastic properties in colorectal cancer.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 500 μg | $1,070 | 35 days | 35 days |
| Description | Pramlintide, a polypeptide analog of human amylin, is an antidiabetic agent with antineoplastic properties in colorectal cancer. |
| In vitro | Pramlintide demonstrates dose-dependent inhibition of HCT-116 and HT-29 cell proliferation, showing greater effectiveness against HT-29 (IC 50 values are 48.67 and 9.10 μg/mL, respectively)[1]. Co-administration of Pramlintide at concentrations of 5, 10, and 20 μg/mL with 5-fluorouracil, Oxaliplatin, or Irinotecan enhances the antiproliferative effect synergistically in both HCT-116 and HT-29 cells[1]. |
| Cas No. | 151126-32-8 |
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) |
| Sequence Short | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY (Disulfide bridge:Cys2-Cys7) |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.