Your shopping cart is currently empty

Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $213 | - | In Stock |
| Description | Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion. |
| Synonyms | Amylin (rat) |
| Molecular Weight | 3920.44 |
| Formula | C167H272N52O53S2 |
| Cas No. | 124447-81-0 |
| Relative Density. | no data available |
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7) |
| Sequence Short | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY (Disulfide bridge: Cys2-Cys7) |
| Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.