Shopping Cart
- Remove All
- Your shopping cart is currently empty
Peptide YY (PYY) (3-36), human (Peptide YY (3-36)), is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $76 | In Stock | |
5 mg | $197 | In Stock | |
10 mg | $318 | In Stock | |
25 mg | $535 | In Stock | |
50 mg | $763 | In Stock | |
100 mg | $987 | In Stock | |
500 mg | $1,980 | In Stock |
Description | Peptide YY (PYY) (3-36), human (Peptide YY (3-36)), is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite. |
Alias | Peptide YY (3-36) |
Molecular Weight | 3980.42 |
Formula | C176H272N52O54 |
Cas No. | 126339-09-1 |
Smiles | CC(C)C[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](C)N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O |
Relative Density. | no data available |
Sequence | Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
Sequence Short | AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.