Shopping Cart
Remove All
Your shopping cart is currently empty
GIP (3-42), human acetate is an antagonist of a glucose-dependent insulinotropic polypeptide (GIP) receptor and regulates insulin secretion and GIP metabolism in vivo.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $227 | Backorder | Backorder | |
| 5 mg | $677 | Backorder | Backorder | |
| 10 mg | $1,085 | Backorder | Backorder | |
| 25 mg | $1,953 | Backorder | Backorder | |
| 50 mg | $2,929 | Backorder | Backorder |
| Description | GIP (3-42), human acetate is an antagonist of a glucose-dependent insulinotropic polypeptide (GIP) receptor and regulates insulin secretion and GIP metabolism in vivo. |
| In vitro | Dipeptidyl peptidase IV rapidly degrades the incretin hormone GIP in the circulation to form the N-terminally truncated peptide GIP(3-42) [1]. |
| Synonyms | GIP (3-42), human acetate(1802086-25-4 Free base) |
| Relative Density. | no data available |
| Sequence | Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
| Sequence Short | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.