Shopping Cart
- Remove All
- Your shopping cart is currently empty
GIP (3-42), human acetate is an antagonist of a glucose-dependent insulinotropic polypeptide (GIP) receptor and regulates insulin secretion and GIP metabolism in vivo.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $227 | Backorder | |
5 mg | $677 | Backorder | |
10 mg | $1,085 | Backorder | |
25 mg | $1,953 | Backorder | |
50 mg | $2,929 | Backorder |
Description | GIP (3-42), human acetate is an antagonist of a glucose-dependent insulinotropic polypeptide (GIP) receptor and regulates insulin secretion and GIP metabolism in vivo. |
In vitro | Dipeptidyl peptidase IV rapidly degrades the incretin hormone GIP in the circulation to form the N-terminally truncated peptide GIP(3-42) [1]. |
Synonyms | GIP (3-42), human acetate(1802086-25-4 Free base) |
Relative Density. | no data available |
Sequence | Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
Sequence Short | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.