Shopping Cart
Remove All
Your shopping cart is currently empty
GIP (3-42), human (Gastric Inhibitory Polypeptide (3-42) (human)) is a peptide that acts as a glucose-dependent proinsulinotropic polypeptide (GIP) receptor antagonist and regulates insulin secretion and the metabolic effects of GIP in vivo, which can be used to study type 2 diabetes.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $196 | In Stock | In Stock | |
| 5 mg | $487 | In Stock | In Stock | |
| 10 mg | $696 | In Stock | In Stock | |
| 25 mg | $1,090 | In Stock | In Stock | |
| 50 mg | $1,490 | In Stock | In Stock | |
| 100 mg | $1,980 | - | In Stock |
| Description | GIP (3-42), human (Gastric Inhibitory Polypeptide (3-42) (human)) is a peptide that acts as a glucose-dependent proinsulinotropic polypeptide (GIP) receptor antagonist and regulates insulin secretion and the metabolic effects of GIP in vivo, which can be used to study type 2 diabetes. |
| Synonyms | Gastric Inhibitory Polypeptide (3-42) (human) |
| Cas No. | 1802086-25-4 |
| Color | White |
| Appearance | Solid |
| Sequence | Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
| Sequence Short | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | DMSO: Soluble H2O: 23.75 mg/mL (5 mM), Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.