Shopping Cart
- Remove All
- Your shopping cart is currently empty
GIP (3-42), human (Gastric Inhibitory Polypeptide (3-42) (human)) is a peptide that acts as a glucose-dependent proinsulinotropic polypeptide (GIP) receptor antagonist and regulates insulin secretion and the metabolic effects of GIP in vivo, which can be used to study type 2 diabetes.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $196 | In Stock | |
5 mg | $487 | In Stock | |
10 mg | $696 | In Stock | |
25 mg | $1,090 | In Stock | |
50 mg | $1,490 | In Stock | |
100 mg | $1,980 | In Stock |
Description | GIP (3-42), human (Gastric Inhibitory Polypeptide (3-42) (human)) is a peptide that acts as a glucose-dependent proinsulinotropic polypeptide (GIP) receptor antagonist and regulates insulin secretion and the metabolic effects of GIP in vivo, which can be used to study type 2 diabetes. |
Synonyms | Gastric Inhibitory Polypeptide (3-42) (human) |
Cas No. | 1802086-25-4 |
Sequence | Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
Sequence Short | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | DMSO: Soluble H2O: 23.75 mg/mL (5 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.