Your shopping cart is currently empty

GEP44 is a peptide-biased triple agonist targeting the glucagon-like peptide-1 receptor (GLP-1R), neuropeptide Y1 receptor (Y1-R), and neuropeptide Y2 receptor (Y2-R). It induces GLP-1R-dependent insulin secretion in rat and human islets by offsetting the actions of Y1-R and GLP-1R agonism, controlled by Y1-R antagonists. Additionally, GEP44 enhances glucose uptake in muscle tissue through Y1-R mediation independent of insulin and significantly reduces food intake and body weight in diet-induced obese rat models. GEP44 is utilized in studies related to obesity and type 2 diabetes.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | GEP44 is a peptide-biased triple agonist targeting the glucagon-like peptide-1 receptor (GLP-1R), neuropeptide Y1 receptor (Y1-R), and neuropeptide Y2 receptor (Y2-R). It induces GLP-1R-dependent insulin secretion in rat and human islets by offsetting the actions of Y1-R and GLP-1R agonism, controlled by Y1-R antagonists. Additionally, GEP44 enhances glucose uptake in muscle tissue through Y1-R mediation independent of insulin and significantly reduces food intake and body weight in diet-induced obese rat models. GEP44 is utilized in studies related to obesity and type 2 diabetes. |
| Targets&IC50 | NPYY2 receptor:34 nM |
| Sequence | His-{d-Ser}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Tyr-Leu-Glu-Glu-Glu-Ala-Val-Arg-Glu-Phe-Ile-Ala-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Short | H-{d-Ser}-QGTFTSDLSKYLEEEAVREFIAWLKNGGPSRHYLNLVTRQRY |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.