Shopping Cart
- Remove All
- Your shopping cart is currently empty
Galanin (1-30), human, is a 30-amino acid neuropeptide that acts as an agonist of GalR1 and GalR2 receptors with Kis of 1 nM for both. This endogenous peptide exhibits multiple endocrine, metabolic, and behavioral effects, influencing intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | TBD | 35 days |
Description | Galanin (1-30), human, is a 30-amino acid neuropeptide that acts as an agonist of GalR1 and GalR2 receptors with Kis of 1 nM for both. This endogenous peptide exhibits multiple endocrine, metabolic, and behavioral effects, influencing intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission. |
Molecular Weight | 3157.46 |
Formula | C139H210N42O43 |
Cas No. | 119418-04-1 |
Relative Density. | 1.31g/cm3 |
Sequence | Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser |
Sequence Short | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.